DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG14314

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:376 Identity:93/376 - (24%)
Similarity:168/376 - (44%) Gaps:40/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKIP 72
            |.::.|:|..:.:....:.: |..|.......:|:||...:.||::..:.:....|. :.|.|: 
  Fly    24 QILSLEVFQDIFKHVEPDVQ-IDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQ-NVICKV- 85

  Fly    73 LVPED------EKNDFHEMFDAELDMYDHLIPELEDLYAKNTS-ISPKFKPVHLKFPGEPVKSDY 130
             :||.      .|:|  ::|..|:..|:.::|||....|..|: .:|.|..:...:   ..:.|.
  Fly    86 -MPESVVAREAYKSD--KLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCY---SARHDL 144

  Fly   131 ILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASA----KRVVELGEYEKDIRESYFTT- 190
            :::||||::|::.:||.:||...|.::||.::||.|..|.    ::.:|.......|.|..|.| 
  Fly   145 LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTA 209

  Fly   191 ------EHQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVL 249
                  .:.:.|.:..|......|....:|.|...:....|.:..::..|     .:....||.:
  Fly   210 NTSWYRNYYERLTKNAIQMVSEVLPPDSKYVLAMNKFAESSSFFGRMVKL-----ASTESPLSAI 269

  Fly   250 NHGDFWCNNFMFKY--KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEY 312
            .|||.|.|||::.|  ::...|.:|..:||||.:|.:.|.|:..:|.......::..:....::.
  Fly   270 CHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKI 334

  Fly   313 YHQQLVEHLTML--NYNRNAPTLSK----FHAHLHRYSLWAFICAQRMLPI 357
            |.::|...|.||  |...:..||.|    |...|..|..:|...|..:|||
  Fly   335 YTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 76/307 (25%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 74/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.