DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG6908

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:410 Identity:138/410 - (33%)
Similarity:211/410 - (51%) Gaps:18/410 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYI 68
            :|.|.|:.::.|..:||:...:.|.|..|.......|||||.|::||...|::|.|.|.:.:||:
  Fly    45 EPIPAWLDQQKFEPILERDFPDLKKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYM 109

  Fly    69 LKI-PLVPEDEKNDFHEMFDAELDMYDHLIPELEDLY---AKNTSISPKFKPVHLKFPGEPVKSD 129
            .|| |.....|.....::|..|.:.|...|||.|.:|   .|..|..|::....::...|     
  Fly   110 AKILPNSGNRENVASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGPRYYESQIELDDE----- 169

  Fly   130 YILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQK 194
            .|:||||.|:|:||.||..||:....||.|:||||:|||||.|....|.|.::..::..:.... 
  Fly   170 LIVLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVVDS- 233

  Fly   195 LLDEFNINFCMPFLECMQQYNLEPGQLVLISD---YTSQLTDLNIEFGKNDPLELSVLNHGDFWC 256
             |.|...|....:::....|:...    |.:|   |.||..|:...|......|..||||||.||
  Fly   234 -LKELRENQLKAYIDAFPLYDASH----LTNDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDAWC 293

  Fly   257 NNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHL 321
            ||.|::|..|.::.:|.|||.|:.::.:||||||.::::|.:..||:.||||.|::||::|:|.|
  Fly   294 NNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIESL 358

  Fly   322 TMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMF 386
            .:|.|.:..|:|...|..:..|..|.......:||:||:....|:::.::|.........:..||
  Fly   359 KLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMDGEGAGDKIRNNMF 423

  Fly   387 LLPAYVDQIKVILPWLINRG 406
            .....:...|.||||...||
  Fly   424 KNHRVIKHQKEILPWAHRRG 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 108/292 (37%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 108/292 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442578
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 188 1.000 Inparanoid score I6344
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.