DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG6834

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:434 Identity:148/434 - (34%)
Similarity:229/434 - (52%) Gaps:58/434 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKI 71
            |:|:.:..|..||......|..|:.|....|::.||||.|::|||.|:::|.|.|.:.|.::||:
  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVKPAMAPGENYATLMLRISIDVELTDKSTKLVCFMLKV 126

  Fly    72 P-LVPEDEKN-DFHEMFDAELDMYDHLIPELEDLY-AKNTSISPKFKPVHLKFPG--EPVKSDYI 131
            | .||:.|:. .....|::|..:|..::|:||:|| ||...|:  |.|...|...  ||..::.:
  Fly   127 PHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDIT--FAPKAFKLDSVKEPKLANTV 189

  Fly   132 LLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTEHQKLL 196
            |:.||.:.|::|.:|.:.|...:.:..||||||:||||:..|...|.||                
  Fly   190 LMSDLSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYE---------------- 238

  Fly   197 DEF-------NINFCMPFLECM------------------QQY--NLEPGQLVLISDYTSQLTDL 234
            |:|       |....|.|.|.|                  :::  .||...:.:..|:...:|  
  Fly   239 DQFVNGVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMT-- 301

  Fly   235 NIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKF 299
                  .||.|.:||||||.|.||.:||..:..||:|:.|||||.||||:|.|||..:::||...
  Fly   302 ------ADPDEFNVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHI 360

  Fly   300 SIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDV 364
            ..|||.|:|||.:||:||.:||.:|.:....|:|.:.|..::::..||...:..:||||||.|:.
  Fly   361 DYKLDYFEYFIRHYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNE 425

  Fly   365 DSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408
            .:...|.:|:||.:..||..::....|...|:.:||||.|:|::
  Fly   426 SATFENFLGDSESSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFL 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 113/317 (36%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 113/317 (36%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.