DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG16898

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:436 Identity:108/436 - (24%)
Similarity:202/436 - (46%) Gaps:68/436 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFK-AIIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILK 70
            |.|:|:|.....|....::.: .::|.....|..||:||::::.||.:|:|..|..:::.:||:|
  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK 67

  Fly    71 IPL---VPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHL--KFPGEPVKSD- 129
            ..|   .|:.:....:::::.|:|||:.::|::.:|          .:.|.|  ||..:.:..| 
  Fly    68 ESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNEL----------LQEVGLTGKFTADTIFVDR 122

  Fly   130 ---YILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYF--- 188
               .|:||||.:..|.||||.:.|:....:..|:.||::||||   :|....:.:.:.:|.|   
  Fly   123 EYRTIILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAAS---IVVKQRHPELLTKSLFIHC 184

  Fly   189 --------TTEHQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLN---------- 235
                    |..::.:|..| |.|          .|.:|   ||...|.::|..::          
  Fly   185 FSRDNKGYTEVYEGVLSAF-IRF----------INEQP---VLKKKYGNKLQKIHENIMDYGART 235

  Fly   236 IEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFS 300
            .|.|:.   ||..|:|||.|..||:::|.:||..:....:|||...:.:|..||......|.:..
  Fly   236 FEVGEQ---ELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDE 297

  Fly   301 IKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFIC--AQRMLPIVLLP-P 362
            :: |.....:|.|:..|..::..|:|....|:|..|.   .::....|:|  |....|:::.. .
  Fly   298 VQ-DMESVLVEKYYSDLKTNVDTLSYKGIFPSLQGFQ---KQFESRRFMCLLAHLFKPVIIYDGT 358

  Fly   363 DVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408
            :|.|...:|..::||.|.|::.::.....:.....:|..|..:|.:
  Fly   359 EVSSDFSSVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 83/315 (26%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 83/315 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.