DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG9259

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:424 Identity:101/424 - (23%)
Similarity:182/424 - (42%) Gaps:73/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FSSLLEQSNRNFKAIIKFV--PTSAISKGENYLTIVLRIQIEMQLKDN-SIEDVSYILKIPLVPE 76
            |...:..|:..|. |:.:.  |||....|  ||...|.:.:.::|.:: .:..:::..|...|..
  Fly    20 FHQDVSNSDTGFD-IVNYTLKPTSDAPAG--YLGSHLYLHVTLKLHNSEEVRQLTFFSKSAPVGN 81

  Fly    77 DEKNDFHE---MFDAELDMYDHLIPELEDLYAKNTSISPK--FKPVHLKFPGEPVKSDYILLEDL 136
            :.:.::.|   :|:.|:.:|.:::|   ||:.....::||  :...:|           ::.|:|
  Fly    82 ESRMEYLEDFGVFEKEIAVYQNVLP---DLHKACAEVAPKCYYADKNL-----------LIFENL 132

  Fly   137 RKKGYRNADRTQGLEQFE-VEAVLKKLAQWHAAS---------------AKRVVELGEYEKDIRE 185
            ..:|||......||..:| :...||.||..||.|               .|.||| ..|..|:  
  Fly   133 ADQGYRMGAGRDGLLTYEQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVE-NAYPSDV-- 194

  Fly   186 SYFTTEHQKLLDEFNINFCM---PFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELS 247
               :.||.:::: |. |.|:   .|::.:.:|..:..  .::.::|.:::.: .|..|...:..:
  Fly   195 ---SPEHMRMVN-FQ-NACLVLKEFIKLIPKYQSKLD--YVLENFTEKMSFI-FEAVKTSDVYQN 251

  Fly   248 VLNHGDFWCNNFMFKYKNASEVEDVC-FVDFQLPKYGTPAQDLLCILM--TSPKFSIKLDKFDYF 309
            .:.|||.|.||.||:|....||...| .|||||.:|..|..|:|.:|.  ||.:|. .....:..
  Fly   252 TILHGDLWANNIMFQYGRYGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFR-DAHLSELL 315

  Fly   310 IEYYHQQLVEHLTM--LNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVM 372
            .||| :.:.|.|..  |:..|..|. ..|:..:.::.....|.:.....:|:|||.....:.:.:
  Fly   316 AEYY-RFMTEFLKRADLDIARFIPE-QTFYESVQKFRSVGLIESCLFCHLVILPPHCTQKLTSSV 378

  Fly   373 GNSEEAIAFKRKMFLLPAY----------VDQIK 396
            ....:....||....|.|:          ||.|:
  Fly   379 DGFNDFFTNKRIEICLEAFNTDELYRSRLVDMIE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 79/315 (25%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 74/297 (25%)
APH <252..325 CDD:279908 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459721
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.