DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:366 Identity:82/366 - (22%)
Similarity:160/366 - (43%) Gaps:65/366 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IIKFVPTSA-ISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHEMFDAELDM 92
            |:.||...| |.||:.....::..::|.|:       .:|.          ::...:|.:.|::.
 Worm    80 IVSFVHIQALIDKGKQQNASLITKEVEEQM-------YAYF----------ESSCKKMHNQEMNF 127

  Fly    93 YDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEA 157
            |     |:...:...|.:.||.. .:.|...:.....:|.:|.:.....|::..|..:|  |::.
 Worm   128 Y-----EVAGKFNSKTLLIPKVY-FYTKLDEKNSNKGFIGMEYVEGSIVRHSYDTCTIE--EIQP 184

  Fly   158 VLKKLAQWHAASAKRVVELGEYEKDIRE----SYFTTEHQKLLDEFNINFCMPFLECMQQYNLEP 218
            :|:.:|:..|.|.:...|:   .||:::    :.|....:.:|.|..|...  |.:|.   |||.
 Worm   185 ILRAIAKLQALSLQNPAEI---SKDLQKIDNGAIFQETLKMMLSESGIKGI--FEQCR---NLER 241

  Fly   219 ---GQLV-LISDYTSQLTDLNIEFGKND--PLELSVLNHGDFWCNNFMFKYKN----ASEVEDVC 273
               |:.| .|.:..:::.|....|..|.  .::.:||.|||.|..||::...|    |:.:    
 Worm   242 SRFGEKVDRIEEKRNEILDFEKAFNLNKVVGIKQNVLCHGDLWAANFLWTENNGVFCATRI---- 302

  Fly   274 FVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAP-TLSKFH 337
             ||:|:...|.||:||:.:|:::...:.:...:...:|.::...:..|.    :..|| ||.:..
 Worm   303 -VDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFYSYFLNELG----SGEAPYTLEQLK 362

  Fly   338 AHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEA 378
            .   .:.|:..:.|..:||  |..|.||:.:..:  :||:|
 Worm   363 L---SFKLYFPVGALALLP--LFGPAVDAKLEGM--DSEKA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 62/299 (21%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 82/366 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.