DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG9497

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster


Alignment Length:434 Identity:106/434 - (24%)
Similarity:178/434 - (41%) Gaps:63/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFKA-IIKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILK 70
            |..:....|..:||.:.|..:. ::........|.||||.:.:.|:::..:..|:..:.:::|:|
  Fly    14 PSHLDVPFFEEVLETALRTARVQLLSIHIRMGSSTGENYCSQIYRVKVSFKRPDHPEQHMAFIVK 78

  Fly    71 -IPLVPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLE 134
             ||.:...|..|..:::..|...|..::|.||.|...|....||... :||.|     .:.::.|
  Fly    79 SIPHLDSVEFIDDLQVYLKEKITYYEVLPRLELLMQCNRRFGPKLYH-YLKQP-----ENSLVFE 137

  Fly   135 DLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESY---------FTT 190
            ||.:||:..|.|..||.:...:.|:::||::||.|    :.|...:..|.::|         ...
  Fly   138 DLAEKGFVMASRELGLNEEHCQLVMERLAEFHATS----MALAVVDPHIFDAYGDGMLSPRGLAK 198

  Fly   191 EHQKLLDEFNIN--------FCMPFLECM----------QQYNLEPGQLVLISDYTSQLTDLNIE 237
            :...|:..|:.|        ...|..|.:          |:.|||..|                 
  Fly   199 DDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLERSQ----------------- 246

  Fly   238 FGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIK 302
              .....|:.||||||.|.||.:|||..|...:|:..:||||..:|:|..||.....||....:.
  Fly   247 --APQEKEVKVLNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSPGIDLNYFFYTSLTLEVL 309

  Fly   303 LDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSH 367
            ..:....:..||.:|.:.|..|:.....|:..:....:||...:.|..:..:.|.|  ..|....
  Fly   310 RHRRTQLLRTYHARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFFASYGIFPTV--SQDKAQT 372

  Fly   368 IGNVMGNSEEAIAFK---RKMFLLPAYVDQIKVILPWLINRGYI 408
            ..|.:.|.::|...|   |:||......|.::..||.....|.:
  Fly   373 ADNNLENFKDADFAKQKVRQMFQSRRLADTLRYTLPHFERAGVL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 82/313 (26%)
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 81/310 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.