DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG33509

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:386 Identity:90/386 - (23%)
Similarity:156/386 - (40%) Gaps:75/386 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHE-MFDAELDMYDHLIPE 99
            |||....:|..:.||...|   ::..|.::...:|  .:|:.......| :|..|..:||.||.:
  Fly    33 SAIGYLGDYYALTLRYCHE---EEEIIREIELFVK--AMPQQSAELSKESIFQKESWLYDTLIKK 92

  Fly   100 LEDLYAKNTSISPKFKPVHLKFPGEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQ 164
            |:.|  .|...||..  |:       .:.|.::||:::.||:.:|...: |.:..|:.::|.:|.
  Fly    93 LQAL--SNVKWSPNC--VY-------SRKDLMVLENIKLKGFTSAGSAE-LNEVFVKPLIKSIAA 145

  Fly   165 WHAASAKRVVE--------------LGEYEKDIRESYFTTEHQKLLDEFNINFCMPFLECMQQY- 214
            :|:||.  |.|              |.|...|...::|||         .::..:..:..:.:| 
  Fly   146 FHSASL--VYEHQTKTNIGHTYGDNLLEITVDSEIAWFTT---------GLSAVLAVVRSLAKYQ 199

  Fly   215 -NLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQ 278
             |.|..   .|.|....:.:...|.........:||.|.|.|..|..|..:|:.   ....:|||
  Fly   200 GNREQS---FIGDKLMGIMETIYEQAAPSKKYRNVLCHRDIWAGNIFFPPENSG---PALLIDFQ 258

  Fly   279 LPKYGTPAQDL-LCILMT-SPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLH 341
            ..:|..||.|| .|:.|. |.....:::|  ..|:.||..|:::|:.|.......:.|:......
  Fly   259 TCRYAPPASDLNFCLYMNLSSSKRKQMEK--QGIDLYHTYLLQNLSDLGLEELVISKSELLESYE 321

  Fly   342 RYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWL 402
            .:.|:..:.......:|.:|.|..::            .||        |||:.||||.::
  Fly   322 EFRLFGVVYRAVAATVVKVPTDFITN------------DFK--------YVDRSKVILSYM 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 73/304 (24%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 67/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.