DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG33510

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:432 Identity:94/432 - (21%)
Similarity:163/432 - (37%) Gaps:105/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDQPTPQWVTK----ELFSSLLEQSN---------RNFKAII---KFVPTSAISKGENYLTIVL 49
            |:.:|.....|:    |||:  ||:.|         :|.:.::   ..||.   ::...:|....
  Fly     1 MSTEPYSPVFTRENRTELFT--LEECNKILANLLADKNEQGVLLNFNIVPA---TEHTGFLGEYF 60

  Fly    50 RIQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFH----EMFDAELDMYDHLIPELEDLYAKNTSI 110
            .:..:.||:|......|.:....::.::...:|:    .:.:.|:.:|| |:.||:.......|.
  Fly    61 HLYFQYQLEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLYD-LLNELKKFSKHVWSA 124

  Fly   111 SPKFKPVHLKFPGEPVKSDYILLEDLRKKGY-RNADRTQGLEQFEVEAVLKKLAQWHAASAKRVV 174
            ...|           .:.|..:::::...|| .....|:.|.:.::..:||.||..||:|.....
  Fly   125 KCYF-----------TRKDLFVMQNVEDMGYVALPPGTRFLNENQMGPILKSLATLHASSIAYEK 178

  Fly   175 ELG-----EYEKDIRE-------SYFTTE----------HQKLLD-----EF---NINFCMPFLE 209
            :.|     |:.|.::|       .::||.          |..:||     |:   .:..|:..:.
  Fly   179 QQGKTIGVEFRKWLKEVSVDPEVEWYTTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVY 243

  Fly   210 CMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCF 274
            ||    :.|                       .|:..:|..|.|.| |..:|.:|.....|....
  Fly   244 CM----VNP-----------------------SPVHRNVFVHRDAW-NANVFYHKEKPHEERSIL 280

  Fly   275 VDFQLPKYGTPAQD--LLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSK-- 335
            |||||.:|..||.|  |:..|...| ||.| ......||.|:..|.|....:..|.....|||  
  Fly   281 VDFQLCRYSPPAMDFHLVTYLNLEP-FSRK-KMIGSLIETYYDALAEEFREMGVNPYQEQLSKQE 343

  Fly   336 FHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEE 377
            |...|:.:||:..........::.||   |:::.|:.....|
  Fly   344 FEQSLNDFSLFGATYNCIAATVLRLP---DNYLKNLKDERPE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 69/322 (21%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 54/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.