DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG33511

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:401 Identity:97/401 - (24%)
Similarity:165/401 - (41%) Gaps:76/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GENYLTIVLRIQIEMQLK-DNSIEDVSYILK-IPL--VPEDEKNDFHEMFDAELDMYDHLIPELE 101
            ||.|     ::.:|.::| |.....::|.:| :|.  .|:.|:.:...:|..|..:|..::|:::
  Fly    44 GEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQ 103

  Fly   102 DLYAKNTSISPK--FKPVHLKFPGEPVKSDYILLEDLRKKGYRN--ADRTQGLEQFEVEAVLKKL 162
            ....|  .:.||  :.           ::|.::|||| .:.||:  |:....|:.:::  ||:.|
  Fly   104 KYATK--KLYPKCYYS-----------RNDILVLEDL-TQDYRHLRANEYYTLDHYKI--VLEHL 152

  Fly   163 AQWHAASAKRVVELGEYEKD---IRESYFTTEHQKLLDEFN---------INFCM---PFLECMQ 212
            ::.||||      :...||:   |.|||.....:..||..|         |.|..   |..:.|:
  Fly   153 SELHAAS------IAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMK 211

  Fly   213 QYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEV--EDVCFV 275
            ..|       .|.|....|.....|.........:||.|.|.|.:|.::.:...|.|  ...|.|
  Fly   212 AQN-------FIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIV 269

  Fly   276 DFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHL 340
            ||||.:|.:|..|:|.:|.......::...:|..:|:|::.|..||..|..::|..|.:.|....
  Fly   270 DFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKEC 334

  Fly   341 HRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAF------KRKMFLL------PAYVD 393
            .|..|.|.:......|...:.|.:.:.:     .|||...|      .|...||      |.|.:
  Fly   335 QRTRLAALVIWALTEPQTKMSPSISNRL-----RSEEPEKFDYYLNCDRSELLLRVIEIQPGYEE 394

  Fly   394 QIKVILPWLIN 404
            .|...:..|::
  Fly   395 TIMTPIRELVD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 78/309 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 77/308 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.