DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG31974

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:330 Identity:87/330 - (26%)
Similarity:151/330 - (45%) Gaps:38/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TSAISK-GENYLTIVLRIQIEMQLKDNSIEDVSYILKIPLVPEDEKNDFHEMFDAELD------M 92
            ||.::| |:||.:|:|.:|.:::..|..|.|:..|.|:|.:..|.   :.::|..|..      :
  Fly    29 TSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTNDL---YWQIFQPERTCITENAV 90

  Fly    93 YDHLIPELEDLYAKNTSIS-------PKFKPVHLKFPGEPVKSD---YILLEDLRKKGYRNADRT 147
            |.:|.|||:.|..::..:.       |::....:.......|.|   .::.|::..:|||..:|.
  Fly    91 YQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRH 155

  Fly   148 QGLEQFEVEAVLKKLAQWHAAS-AKRVVELGEYEKDIRESYFTTEHQKLLDEFNINFCMPFLECM 211
            :.....|...:|..|||:||.. |.|:.:...||:.:| .||     |..| .|.|......|.|
  Fly   156 RPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVR-PYF-----KKFD-MNSNIDQAETEIM 213

  Fly   212 QQYNLEPGQLVLISD----YTSQLTDLNIEFGKNDPLE---LSVLNHGDFWCNNFMFKYKNASEV 269
            .:..|:..:||...:    ...:|.|:...|..::.::   .:.|.|||.|.||.|.||....|.
  Fly   214 NKEILKDIKLVTSDERDVNRVKELLDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMRGEE 278

  Fly   270 E---DVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAP 331
            .   .|..||||:.:||:...|::.:|.:|...::..|.|..|:..|:...::.|..:|.:.:..
  Fly   279 GTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSVNVDTSNY 343

  Fly   332 TLSKF 336
            |...|
  Fly   344 TYELF 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 82/313 (26%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 81/311 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459634
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.