DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG31436

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:444 Identity:108/444 - (24%)
Similarity:178/444 - (40%) Gaps:85/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFKAIIK-----FVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVS 66
            |:|:..|..:.:||  ....:|.:|     |.|.||  ||::|.:|:.|.:::...:....:. |
  Fly    18 PEWLNSEFMARVLE--GNELEAAVKVIDLTFSPASA--KGDHYASIMFRARVKYTNRKGEFQK-S 77

  Fly    67 YILKIPLVPEDEKNDF---HEMFDAELDMYDHLIPELE----------DLYAKNTSISPKFKPVH 118
            .|:|.....|..|.|.   ..:|:.|:.:|..::||.|          .||.  ..|....:|  
  Fly    78 LIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYV--NCIYHSLEP-- 138

  Fly   119 LKFPGEPVKSDYILLEDLRKKGY---RNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYE 180
                     ...::.|||.:.||   |:.|.|..    |:..:..|||:|||.|.|...|..|:.
  Fly   139 ---------HQVLIFEDLAEMGYIVLRDRDATLD----EIRRIYFKLAKWHAVSLKVQNEQPEFL 190

  Fly   181 KDIRESYFTTEH---------------QKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDY--- 227
            :......|...|               :.|..|..:|...|:.|.::...||.    |:.::   
  Fly   191 ESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLER----LVEEWKDI 251

  Fly   228 -TSQLTDLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLL- 290
             .||..|           |..||.|||....|.|||:|:...:||...:|||:........||| 
  Fly   252 RKSQKKD-----------EYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLY 305

  Fly   291 -CILMTSPKFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRM 354
             ..::..|:.  :.:.:|..|.||...|.:.|..:.|....|:.|.....||::..:.|......
  Fly   306 SIYMLLEPEH--RWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTF 368

  Fly   355 LPIVLLPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408
            ||::....|.....|:::.|.|:    :||......|:.::.::|..|...|.:
  Fly   369 LPLMWALRDKSVDFGDLLQNEEK----RRKCSFSKGYIKEVTILLARLDQLGLL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 79/322 (25%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 79/322 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.