DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG31380

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:418 Identity:112/418 - (26%)
Similarity:196/418 - (46%) Gaps:46/418 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WVTKELFSSLLEQSNRNFKAIIK-FVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYILKIP 72
            |:|.|...:.|.:..:|.:..:: .|...|:.|||||..|:.||    .|..:||.:...|.|..
  Fly     4 WLTAEYLEAALRRYYQNNELRVESMVINPALGKGENYGAILTRI----HLVYSSIVEEHLIAKTV 64

  Fly    73 LVPEDEKNDF----HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPVKSDYILL 133
            |..||.:...    :::::.||::|:.::|:|::|..:  .:.||.  :|:     ..:...:::
  Fly    65 LEYEDAETKMKKAPYDIYNRELEIYEQVLPKLQELAGE--QLCPKI--LHI-----DRQRGALIM 120

  Fly   134 EDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFT-TEHQK-LL 196
            |||..||:..|.|.|.|::..|..||:|||:..||||       ..|.::.|:.|: ||:.| ..
  Fly   121 EDLSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASA-------VLENNLLENNFSLTEYDKGFF 178

  Fly   197 DEFNINFCMPFLECMQQ----YNLEPG---QLVLISDYTSQLTDLNIEFGKNDPLELSVLNHGDF 254
            :.:..:|...||.|::.    ...:.|   ...|:.:.......|.:...|.:...::||.|||.
  Fly   179 NRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQEQTHINVLTHGDL 243

  Fly   255 WCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVE 319
            |.||.||||: |....||..:|||...:|:|..|:..:|.||....::.:........||...|.
  Fly   244 WTNNMMFKYE-AGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVG 307

  Fly   320 HLTMLNY-NRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIAFKR 383
            .|..|.: .:..|:..:||....:...:|..|...:||::|...:.|:....::.:....:..||
  Fly   308 ELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLLNTDETDADFAALLSDQPRGMDMKR 372

  Fly   384 KMFLLPAYVDQIKVIL----------PW 401
            :::|.|...|.||.::          ||
  Fly   373 RLYLNPGIQDSIKQMVKHFELEGLLDPW 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 87/298 (29%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 87/298 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.