DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG2004

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:184/434 - (42%) Gaps:98/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KFVPTSAISKGENYLTIVLRIQI-----------EMQLKDNSIEDVSYILKIPLVPED--EKNDF 82
            ||.|:.  .||:.||:.|.||.|           |.||      ::|.|:|  .:|::  .:..|
  Fly    35 KFGPSG--KKGDAYLSRVFRITIYGVKEAEEGQDEKQL------EISVIVK--AMPDNLHRRRLF 89

  Fly    83 HEM--FDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFP--------GEPVKSDYILLEDLR 137
            ..:  |..|::.|..::|.:| .:.|:...:|| || .:::|        |   .:|:|.|||:.
  Fly    90 RSVIFFRNEINFYTKVLPAIE-AFQKSRQPAPK-KP-FVEYPRCLASLCDG---VNDFIALEDVG 148

  Fly   138 KKGYRNADRTQGLEQFEVEAVLKKLAQWH-AASAKRVVELGEYEK---DIRESYFTTEHQKLLDE 198
            .:|||...|...:...:....::.|.::| .|.|...::...:||   .:.|:|: .||.:   |
  Fly   149 PRGYRAPVRQDYISLEDALLTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYY-GEHTR---E 209

  Fly   199 FNINFCM----PFLECMQQYNLEPGQLVLISDYTSQLTD----------LNIEFGKNDPLELSVL 249
            :...|.:    ...:.::|  :.|.     |.|.:..|:          :|:...::   :|||.
  Fly   210 WYTGFLLLAENVATDAVKQ--IYPN-----SKYETVATNFLQPPLFDDLINLVSTRS---KLSVF 264

  Fly   250 NHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYY- 313
            .|||.|..||:.||....:.|::..:||||.:..:.|.||...:.:.....::...:|..:..| 
  Fly   265 GHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYL 329

  Fly   314 --HQQLVEHLTMLNYNRNAPTLSKFHA---HLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMG 373
              .|.|::.|     ..||.::..:.:   .|..:..:........||:.::.   |..:.::.|
  Fly   330 ESAQDLIQDL-----GGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMME---DDEVADLDG 386

  Fly   374 NSEEAI--------AFKRKMFLLPAYVDQIKVILPWLINRGYIR 409
            ..|.||        .||..     |...::..|....|::|||:
  Fly   387 IKENAILTDIWNITPFKES-----AKQQRLADIFKHAIDQGYIK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 79/329 (24%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 79/330 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.