DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG32195

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:431 Identity:109/431 - (25%)
Similarity:176/431 - (40%) Gaps:87/431 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KELFSS--------------LLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLK-DNS 61
            :|::|:              :|...|.:.||:.:        ||||:.:::.|:.:..:.. |.:
  Fly     3 REIYSAEYFERALARAYGCEMLRVENFHIKAVSQ--------KGENFCSVIYRVALVFRRSPDGA 59

  Fly    62 IEDVSYILK--IPLVPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGE 124
            :|...||||  :|.......|        |.||::.|:|.::.:..:    :||....|      
  Fly    60 LESGKYILKDLLPAAAALGTN--------EKDMFEVLLPAMQAILEE----APKEIGEH------ 106

  Fly   125 PVKSDYIL-----------LEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGE 178
            .:.:|.:|           ||||...||.:.||.|||...|.:..::||||:|.||.....:..|
  Fly   107 KLSADCLLVEISAGKELYILEDLGALGYESFDRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPE 171

  Fly   179 YEKDIRESYFTTEHQKLLDEFNINFCMPFLECMQQYNLE--PGQLVLISD---------YTSQLT 232
            ..:.:..|::.       :..|..|....:....:|..|  ..:|..||.         ||.::.
  Fly   172 LIQRLSPSHYA-------NGLNDRFAQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMR 229

  Fly   233 DLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSP 297
            |: ::..|:   .|:.:.|||.|.||.||.:.|    :....||||...:|:||.||..:..||.
  Fly   230 DV-VDPNKS---SLNAVIHGDPWLNNIMFDFVN----KKATLVDFQNCYWGSPAIDLYFLFYTSL 286

  Fly   298 KFSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHR---YSLWAFICAQRMLPIVL 359
            |..:.|:..|..:.||...|:|.|....|....||..:....:.|   |..:..:|.   |||..
  Fly   287 KPELLLNNQDELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGYYTVVCE---LPICC 348

  Fly   360 LPPDVDSHIGNVMGNSEEAIAFKRKMFLLPAYVDQ-IKVIL 399
            ..|:.....|.......:|:..||........|.| ||..|
  Fly   349 ASPEASVDFGVHTFVDTDAMLKKRHQLFASERVRQTIKATL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 84/310 (27%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 84/310 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.