DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and F58B4.5

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:229 Identity:54/229 - (23%)
Similarity:87/229 - (37%) Gaps:40/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HLKFP------GEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVE---AVLKKLAQWHAASAKRV 173
            |.|.|      .:|...:..|...|..:.|.|.......|....|   .|:..:|.:.|...|..
 Worm   130 HPKIPFTKVYASKPFDDENKLKAYLISEYYPNIHHIGMHESIPAEDLIPVIHAIAAFSAIGMKLS 194

  Fly   174 VELGEYEK-----DIRESYFTTEHQKLLDEFNI----NFCMPFLECMQQ-------YNLEPGQLV 222
            .|..:|.:     ||....|..|  |.::..|:    :|...:||.:::       |..:| |::
 Worm   195 EEETKYARGADFLDIVFGQFMDE--KSIERMNVLLKASFPEEYLEKVEEMLKIYKDYYFQP-QMI 256

  Fly   223 LISDYTSQLTDLNIEFGKNDPLELSVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQ 287
            .....|.|.      ||..     .||.|.|.|.:||:.. ::..:|.....:|||.....||||
 Worm   257 KNFKNTCQF------FGYK-----PVLTHSDLWSSNFLCT-RDGEKVTLKAIIDFQTVSITTPAQ 309

  Fly   288 DLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHL 321
            |:..:..:......:.:|.|:.:|.|:...|..|
 Worm   310 DVGRLFASCLSTKDRREKADFLLEEYYNTFVNEL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 54/229 (24%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 54/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.