DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and pkdc

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:267 Identity:64/267 - (23%)
Similarity:97/267 - (36%) Gaps:77/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VEVTFGAKSYELKNAQTEYISLEDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHAATAVRVATK 175
            |.:...|||:    .:.:.|.||||.:.||  ..|...::.|..:..|..:|.:| |..:.|..:
Zfish    95 VPLCLAAKSF----GEEQLIVLEDLDVAGF--PVRKTYVNDAEIKACLSWIANFH-ALFLDVTPE 152

  Fly   176 GQYPEIVLNGFFKEENRPMMNDMMNGMGQVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMCVV 240
            |.:|   :..::..|.||...:.|:.                   :|:||... .||.:...|  
Zfish   153 GLWP---IGTYWHLETRPEELEAMSD-------------------QKLKAAAG-EIDSILNNC-- 192

  Fly   241 DPTEFNVLNHGDSWSNNIMFQYDESGKIKEVYMVDFQVSKYGTVAQDLYYFL---ISSTKLEDKL 302
               .|..:.|||:...|..|..|.    .:|..||||....|...:|:.|||   :...:.|.|.
Zfish   193 ---RFKTIVHGDAKLANFCFSKDG----LQVASVDFQYVGGGCGMKDVIYFLGSCMDERECEKKA 250

  Fly   303 -SKFDYYVKVYHDNLVE--------------------------------HLKILKYSKPLPS--L 332
             ...|||......:|.:                                |.||.||||.|..  |
Zfish   251 PGLLDYYFSELRKSLEKKVDFAELEKEWRNMFAFAWTDFHRFLLGWMPGHHKINKYSKRLTQEVL 315

  Fly   333 RDIHKSL 339
            :.:.:||
Zfish   316 KKLKQSL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 56/249 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 52/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.