DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and CG33511

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:391 Identity:89/391 - (22%)
Similarity:171/391 - (43%) Gaps:96/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKE--LSYMVK-LPRQREINK 79
            ::.|.||..||      ::....|:.|     ::::|.|:: |..|:  |:|.:| |||:.|..:
  Fly    27 LINSQVDAGSK------DLMGYMGEYY-----KLHLEAEVK-GDKKKYFLNYFIKSLPRKNEPQR 79

  Fly    80 EMMKHNNIFEIERTMYNLVVPEME-----ALYKAAGVEVTFGAKSYELKNAQTEYISLEDLCIKG 139
            |..:...:|:.|..:|:.::|:::     .||          .|.|..:|   :.:.|||| .:.
  Fly    80 EECERKGVFQKESALYSQILPKIQKYATKKLY----------PKCYYSRN---DILVLEDL-TQD 130

  Fly   140 FKN--ANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYPEIVLNGFFKEENRPMMNDMMNGM 202
            :::  ||....||  |.:.||..|::.|||:.               .:.::||..:.....|.:
  Fly   131 YRHLRANEYYTLD--HYKIVLEHLSELHAASI---------------AWEEKENVKIYESYKNVL 178

  Fly   203 GQVFVKCCSTYEGNEAYIEKVKAL---------------KDVMIDELFKMC-----VVDPTEF-- 245
            .::.:.     ..|..||..:||:               ::.:.|:|:.:.     :|.|::.  
  Fly   179 IELHLD-----SNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIR 238

  Fly   246 NVLNHGDSWSNNIMFQYDESGKI--KEVYMVDFQVSKYGTVAQDLYYFLISSTKLEDKLSKFDYY 308
            |||.|.|:|.:||::.:::...:  ....:||||:::|.:...|:.:.|......|.:.:.:|..
  Fly   239 NVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDEC 303

  Fly   309 VKVYHDNLVEHLKILKYSKPLPSLRDIHKSLYKYGTFAYSVATGVMAAVLVDPTE-----SASFE 368
            ::.|:.||..||..|...|.|.:..:..|...:         |.:.|.|:...||     |.|..
  Fly   304 LEHYYKNLQHHLDRLGLDKNLITENNFRKECQR---------TRLAALVIWALTEPQTKMSPSIS 359

  Fly   369 N 369
            |
  Fly   360 N 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 73/317 (23%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 72/319 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459696
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.