DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and CG31974

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:397 Identity:101/397 - (25%)
Similarity:173/397 - (43%) Gaps:65/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKIPDWVTAERFEDVLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKELSYM 68
            |::|   ..:....|::.::.....:.::.....:..||||.:.||.|..::...||..::|..:
  Fly     2 GEVP---KIKNLPQVIEPHLPEGCTLDSYSTSYLTKPGDNYGSIMLSVQAKIRSADGGIRDLPLI 63

  Fly    69 VKLPRQREINKEMMKHNNIFEIERT------MYNLVVPEMEALYKAAGV---EVTFGAKSY---- 120
            .|||   .:..::  :..||:.|||      :|..:.||::.|...:|:   ::..|...|    
  Fly    64 AKLP---PLTNDL--YWQIFQPERTCITENAVYQYLSPELDKLQLESGILPAQIFDGFPRYYGSR 123

  Fly   121 -ELKNAQTE-----YISLEDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYP 179
             .|.|..|:     .:..|::..:|::..||....:.|.|..:|..|||:||........|.|..
  Fly   124 VSLDNRATKVDRDAVLVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQVY 188

  Fly   180 EIVLNGFFKEENRPMMNDMMNG-----MGQVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMC- 238
            |..:..:||:.:   ||..::.     |.:..:|.......:|..:.:||.|.|:.  :.|:.. 
  Fly   189 EEYVRPYFKKFD---MNSNIDQAETEIMNKEILKDIKLVTSDERDVNRVKELLDIF--QAFQASN 248

  Fly   239 VVDPTEFNVLNHGDSWSNNIMFQY---DESGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLED 300
            .||...|..|.|||.|.||:|.:|   .|.|...:|.:||||:::||::..|:.:.|.||..   
  Fly   249 DVDDGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVD--- 310

  Fly   301 KLSKFDYYVKVYHDNLVEHLKILKYSKPLPSLRDIH--KSLYKYGTFAYSV----------ATGV 353
                    |.|..||....|.|. |:..:.:||.::  .|.|.|..|...|          |..:
  Fly   311 --------VNVLEDNFYNFLTIY-YNAFIQTLRSVNVDTSNYTYELFLEEVQQTAHVQLPHAIFM 366

  Fly   354 MAAVLVD 360
            |..:|.|
  Fly   367 MKVILAD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 86/311 (28%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 89/323 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.