DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and CG1561

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:368 Identity:92/368 - (25%)
Similarity:153/368 - (41%) Gaps:79/368 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KAEMGSAAGDNYATNMLRVNIEVELQDGTTKELSYMVKLPRQREINKEMMKHNNIFEIERTMYNL 97
            :.|..||.||||      :.:...||..:..:.|.:||||.|..:.::.......|..|...|.:
  Fly   250 RLERASAKGDNY------LGVVWRLQAASDSKRSLVVKLPPQNRVRRKQFFARPCFLRETAAYEV 308

  Fly    98 VVPEMEAL----YKAAGVE------VTFGAKSYELKNAQTEYISLEDLCIKGFKNANRLEGLDQA 152
            .:| :.||    :|..|.:      :.||.:..|    ..|.|.||||...||...||...|...
  Fly   309 FLP-LTALIQDKWKIIGDDRFRQHALCFGTRQDE----PNECIVLEDLSCAGFSLHNRFLDLSVE 368

  Fly   153 HTERVLRKLAQWHAATAVRVATKGQYPEIV------------------LNGFFKEENRPMMNDMM 199
            |..||:...|:.|   |:.:|.|.|.||.:                  |..:|:......::.::
  Fly   369 HVRRVMLTYAKLH---AISLAGKRQLPEKMQQLQQLVDIFEQRRDDHALGVYFENLKESALSALL 430

  Fly   200 NGMGQVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMCVVDPTEFNVLNHGDSWSNNIMFQYDE 264
            ......:......|....:|.|.:..|......|          .|.|:.|||.|:|||:::..|
  Fly   431 APADDAYRVRLEAYFARGSYFELLLPLVSGFNCE----------PFAVICHGDCWNNNILYKSTE 485

  Fly   265 SGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTK-------LEDKLSKFDYYVKVYHDNLVEHLKI 322
            .|::::|.::|:|:.:|.:...||.|||.:.|.       ||:.|.  |||.::       .|::
  Fly   486 RGELEDVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLE--DYYEEL-------GLQL 541

  Fly   323 LKYSKPLPSLRDIHKSLYKYGTFAYSVAT----GVMAAVLVDP 361
            ::..:.:       :.|:....|...|||    |::.|::|.|
  Fly   542 IRLGERV-------EQLFPRPAFDEQVATKAAVGLLLAMMVLP 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 80/318 (25%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 80/321 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.