DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and nhr-246

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:373 Identity:73/373 - (19%)
Similarity:147/373 - (39%) Gaps:104/373 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YATNMLRVNIEVELQDGT-----TKELSYMVKLPRQR--EINKEMMKH----------------- 84
            :...::.:.|.|:.:.||     ..||.:|..|.:.|  ..|.::.||                 
 Worm    15 WLAELIEIKIGVKPKIGTVGILENSELGFMSLLRKVRLHFDNDDLPKHVVLKIPQNTKGCSVVEN 79

  Fly    85 -----NNIFE--IERTMYNLVVPEMEALY---------KAAGVEVTF-GAKSYELKNAQTEYISL 132
                 .|:..  :||.|:|     .|..|         |...:..|: .:|:.|  .|....|.|
 Worm    80 AGGGVKNVDHSVVERFMHN-----TECNYYKLFSSLSEKPLQIPTTYLASKAGE--KAPVPVIVL 137

  Fly   133 EDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYPE---IVLNGFFK----EE 190
            |  .::..|..:.:.|.::....:::.:|.:.|..:......|...|:   :.::||.:    :.
 Worm   138 E--MLEDCKLHDLIPGFNEDQLFKIVDELVKLHIFSLTTEKWKEIVPDESKLAMSGFLQCMVADV 200

  Fly   191 NRPMMNDMMNGMGQVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMCVVDPTEFNVLNHGDSWS 255
            .|.:..:...|:...:|:  :|.:.:..|::|   ::|..|:|         ...:|:.|||.|:
 Worm   201 GRKLAQNPELGVILSYVE--NTLDTDPNYLQK---MRDEYINE---------ERPSVICHGDLWA 251

  Fly   256 NNIMFQYDESGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLEDKLSKFDYYVKVYHDNLVEHL 320
            ..|:  :|:...|..:  ||:|.:..|:..:||::.|.:.|.::::        |.:...|::|.
 Worm   252 PQIL--WDKEDNIAGI--VDWQATHRGSPMEDLHHILSTCTSVQNR--------KTFTKPLLDHY 304

  Fly   321 KILKYSKPLPSLR-------------DIHKSLYKYGTFAYSVATGVMA 355
                |:|....|:             ||.   |.| :|.|..:..:.|
 Worm   305 ----YNKLKVGLKEKGFKTTWTREEIDIE---YNY-SFIYGASRTIFA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 63/328 (19%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 42/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.