DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and T16G1.6

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:434 Identity:83/434 - (19%)
Similarity:167/434 - (38%) Gaps:97/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTAERFEDVLKSNVDGYSKVRNFKAEMGSAAGDNYATNMLRVNIEVELQDGTTKEL--------- 65
            :|||:.  .:..|.:|..:...:..::..|.|:       ::|.|..|.:.|...:         
 Worm     1 MTAEKL--TILDNGEGLFQTHVYVKDVQEAIGE-------QMNTESRLGENTKYTVVGDGNGFMS 56

  Fly    66 ------------------SYMVKLPRQREIN--KEMMKHNN--IFEIERTMYNLVVPEMEALYKA 108
                              .:::|:.....::  .:.||.:|  |.|.|..::.:...|.:.|:..
 Worm    57 RVVLVEPEWTITENHLPKKFILKICSSLHVHGIVDKMKESNQSINENEEELWAMFENEAQHLHNR 121

  Fly   109 AGVEVTFGAKSYELKNAQTEYISLEDLCIKGFKNANRLEG------LDQAHTERVLRKLAQWHAA 167
               ||.|...: |..|...|.::.:....|.|.:.|:|:|      :|......:...|..:...
 Worm   122 ---EVNFYVLA-EKWNKPEELLNAKIFFSKKFDSENKLKGFLGMEYVDDVTIRHLYCNLKPYELH 182

  Fly   168 TAVRVATKGQYPEIVL--------NGF-FKEENRPMMNDMMNGMGQVFVKCCSTYEGN-----EA 218
            ..::...:.|...:.|        :|| ||:    ||..|.|..|         .:||     :.
 Worm   183 PVLKAVAQLQAESLHLSDEELQSISGFDFKQ----MMGTMFNDDG---------LKGNYKQTRDI 234

  Fly   219 YIEKVKALKDVMIDELFKMCVVDPTEF------------NVLNHGDSWSNNIMFQYDESGKIKEV 271
            ..|::|...|::  |.|.|.||: .||            :||.|||.|:.||::. :..||....
 Worm   235 NPERLKEKTDIV--EAFGMEVVN-FEFAGNLNKVVGIHKDVLVHGDLWAANILWN-ENDGKFSAS 295

  Fly   272 YMVDFQVSKYGTVAQDLYYFLISSTKLEDKLSKFDYYVKVYHDNLVEHLKILKYSKPLPSLRDIH 336
            .::|:|:...|..|:||....:.:....|:.:.::..::.:::..:|.|:..:....|..|::.:
 Worm   296 KVIDYQIIHMGNPAEDLVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALEDNEIPYTLDQLKESY 360

  Fly   337 KSLYKYGTFAYSVATGVMAAVLV----DPTESASFENFVGDSAE 376
            :..:..|:.......|.:|...:    |......:...:.:.||
 Worm   361 RLYFVTGSLVMLPLYGPIAQTKLSYSKDTEHVEEYREILTEKAE 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 69/346 (20%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 80/425 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.