DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and C29F7.2

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:290 Identity:67/290 - (23%)
Similarity:126/290 - (43%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NKEMMKHNNIFEIERTMYNLVVPEMEALYKAAGVEVTFGAKSYELKNAQTEYISLEDLCIKGFKN 142
            |.|:..||.    |...|.:.....|   |...:.|.:.|...|.|.|....|.:|  ..:..|.
 Worm    98 NVELFMHNT----ECNYYKIFAKLTE---KPLHLPVIYAAIKAEDKEAPVPVIVME--MFEDCKV 153

  Fly   143 ANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYPE---IVLNGFFKEENRPMMNDMMNGMG- 203
            .:.:.|.::....:::.::.:.|..:......|...|:   :.:.|:|:        .|:.|:| 
 Worm   154 YDIITGFNEEQLYKIVDEIVKLHIFSLTTEEWKTIVPDAFVLEMAGYFQ--------TMVAGIGE 210

  Fly   204 ----QVFVKCCSTYEGNEAYIEKVKALKDVMIDELFKMCVVDPTEFNVLNHGDSWSNNIMFQYDE 264
                |..::..|||..| .:....|.|:::. ||     .::....:||.|||.|:..|:  :|:
 Worm   211 KLAQQPGLELVSTYIKN-TFATDPKFLQNIN-DE-----YLEERRISVLTHGDLWAPQIL--WDK 266

  Fly   265 SGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLEDK--LSK--FDYYVKVYHDNLVEHLKILKY 325
            :..|..:  :|:|::..|:..:|.::.:.:.|.:|::  |:|  .||    |.|.|...|: .|.
 Worm   267 NDDIAGI--IDWQITHRGSPMEDFHHIMSTCTSVENRKNLTKPLLDY----YFDKLSSGLE-AKG 324

  Fly   326 SKPLPSLRDIHKSLYKYGTFAYSVATGVMA 355
            .| :|..|:..:..||| :|....|..:.|
 Worm   325 VK-MPWTREEIEEEYKY-SFINGAALTIFA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 57/258 (22%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 43/203 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.