DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and T16G1.4

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_506236.2 Gene:T16G1.4 / 179776 WormBaseID:WBGene00011798 Length:424 Species:Caenorhabditis elegans


Alignment Length:363 Identity:70/363 - (19%)
Similarity:135/363 - (37%) Gaps:91/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KLPRQREIN-----KEMMKHNNIFEIERTMYNLVVPE--------MEALYKAAGVEVTFGAKSYE 121
            :|...||:|     |:..|::.:...:...|.....|        |||:.......:.:..|.:|
 Worm   117 RLFHNREVNLYKITKKWNKNDELLSPKIYFYKKFDSENQTKGILGMEAVDDVTVRHLYYNVKPFE 181

  Fly   122 LKNA-------QTEYISLEDLCIKGFKNANRLEGLDQAHTERVLRKLAQWHAATAVRVATKGQYP 179
            |.:.       |.|.:.|.|      :....:.|.|       |:|::                 
 Worm   182 LHSVLKSIARLQAESLHLTD------QEKQSIAGFD-------LKKMS----------------- 216

  Fly   180 EIVLNGFFKEENRPMMNDMMNGMGQVFVKCCSTYEGNEAYIEKVKALKD---------VMIDELF 235
                |..|.||.      |.|...|       |.|.|.   |::|...|         |.:|:..
 Worm   217 ----NTIFSEEG------MQNNFKQ-------TREINP---ERLKESVDKVEIYGTELVDLDKAI 261

  Fly   236 KMCVVDPTEFNVLNHGDSWSNNIMFQYDESGKIKEVYMVDFQVSKYGTVAQDLYYFLISSTKLED 300
            .:......|.:||.|||.||.||:::.:| ||.....::|:|:...|..|:||...|:.:....|
 Worm   262 NLNSYIGIERDVLVHGDLWSANILWEENE-GKFLVSKVIDYQLIHMGNPAEDLVRLLLCTLSGAD 325

  Fly   301 KLSKFDYYVKVYHDNLVEHLKILKYSKPLPSLRDIHKSLYKYGTFAYSVATGVMAAVLVDPTESA 365
            :.:.::..::.:::..:|.|:..:....|..|::.::.        |.|..|:....:..|....
 Worm   326 RQAHWERLLEQFYEYFLEALQDNETPYSLEQLKESYRQ--------YFVTAGLFMLPMFGPIAQM 382

  Fly   366 SFENFVGDSAEGADFQMKMYNNPRYRKHMQAILPWLLN 403
            .. ::..|:....:::..:  ..:..:.|:.:..|.|:
 Worm   383 KL-SYSSDNEHAEEYREVL--TEKAERLMEDLERWHLH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 60/283 (21%)
T16G1.4NP_506236.2 DUF1679 7..419 CDD:369592 70/363 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.