DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov1 and T16G1.7

DIOPT Version :9

Sequence 1:NP_001097918.1 Gene:CHKov1 / 43067 FlyBaseID:FBgn0045761 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:375 Identity:89/375 - (23%)
Similarity:156/375 - (41%) Gaps:92/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TNMLRVNIEVELQDGTTKELSYMVKLPRQREI-------NKEMMKHN---NIFEI-ERTMYN--L 97
            |:.|.|:..||...|.:..     ..|.::|.       |:....||   |:::| |:...|  :
 Worm    83 TSCLHVHGLVEKMKGKSPG-----AFPAEQEAALWAIFENEAQQLHNREVNLYKITEKWNKNETM 142

  Fly    98 VVPEMEALYKAAGVEVTFGAKSYELKNAQTEYISLE---DLCIKG-FKNANRLEGLDQAHTERVL 158
            :.|::            :..|.::.:|.....:.:|   |:.|:. :.||...|      ...||
 Worm   143 LSPKI------------YFYKKFDAENKTKGILGMEFVSDVTIRHLYCNAKPYE------LHPVL 189

  Fly   159 RKLAQWHAATAVRVATKGQYPEIVLNGF-FKEENRPMMNDMMN--GMGQVFVKCCSTYEGN-EAY 219
            |.||...|.:.  ..|:.:...|  :|| ||:    ||..|||  ||..::.:   |.|.| |..
 Worm   190 RSLATLQAGSL--HLTEDEINSI--SGFDFKQ----MMGAMMNEEGMKNIYEQ---TREINPERL 243

  Fly   220 IEKVKALKDVMIDELFKMCVVD-----------PTEFNVLNHGDSWSNNIMFQYDESGKIKEVYM 273
            .||...:      |.|.:.||:           ..|.:||.|||.|:.||:::.:..||.....:
 Worm   244 TEKTNTV------EAFGLEVVNFELSCNLNKYVGIERDVLVHGDLWAANILWKEENDGKFSVSKV 302

  Fly   274 VDFQVSKYGTVAQDLYYFLISSTKLEDKLSKFDYYVKVYHDNLVEHLKILKYSKPLPSLRDIHKS 338
            :|:|:...|..|:||....:|:....|:.:.::..::.:::..:|   .|...||..||..:.:|
 Worm   303 IDYQLIHMGNPAEDLVRVFLSTLSGADRQAHWERLLEQFYEYFLE---ALGDDKPPYSLEQLKES 364

  Fly   339 LYKYGTFAYSVATGVMAAVLVDP-----------TESA-SFENFVGDSAE 376
             |:    .|.|:.|::...:..|           |||. .:...:.:.||
 Worm   365 -YR----CYFVSGGLVMMPMYGPIAQVKLSYSNDTESVEEYREILTEKAE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov1NP_001097918.1 EcKinase 41..325 CDD:397213 74/310 (24%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 89/375 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.