DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and pkdc

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:326 Identity:63/326 - (19%)
Similarity:112/326 - (34%) Gaps:101/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VKIEVELQDGKSKSVSYMV-------------KLPHQVEAIQEMMKRTNIFEIERTMYNEVVPEL 102
            :::.:|..|..|..|.:::             .:.||        ::...:::|...|...... 
Zfish    35 IRVHLEGCDRPSVVVKHVMFPQNQKHPGGWNTDISHQ--------RKVRSYQVETYWYQNYTTN- 90

  Fly   103 EALYKAVGVDITFGAKNYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAA 167
                :...|.:...||::    .:...:.||||.:.||  ..|...::....:..|..::.:||.
Zfish    91 ----ENCRVPLCLAAKSF----GEEQLIVLEDLDVAGF--PVRKTYVNDAEIKACLSWIANFHAL 145

  Fly   168 SAVRVATKGPYPKILLQGFFKEESRPVMSEMIKGMGANFVKSCATYEGHEAYLDKVKALQPVAID 232
             .:.|..:|.:|   :..::..|:||   |.::.|....:|:.|.                 .||
Zfish   146 -FLDVTPEGLWP---IGTYWHLETRP---EELEAMSDQKLKAAAG-----------------EID 186

  Fly   233 KIFEFAKVEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFL---LS 294
            .|....:     |..:.|||:...|..|..|..    :|..||:|....|...:|::|||   :.
Zfish   187 SILNNCR-----FKTIVHGDAKLANFCFSKDGL----QVASVDFQYVGGGCGMKDVIYFLGSCMD 242

  Fly   295 STKLEDKL-AKFDYYIKIYHDNLVE--------------------------------HLKILKYS 326
            ..:.|.|. ...|||......:|.:                                |.||.|||
Zfish   243 ERECEKKAPGLLDYYFSELRKSLEKKVDFAELEKEWRNMFAFAWTDFHRFLLGWMPGHHKINKYS 307

  Fly   327 K 327
            |
Zfish   308 K 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 59/322 (18%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 47/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589369
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.