DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and CG18765

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:419 Identity:129/419 - (30%)
Similarity:201/419 - (47%) Gaps:59/419 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKIPDWVTAEIFEDLLKANVDGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVSYM 68
            :.:|.||..:..|.|:| .:..:.||::.:....:...|.    .|.|.|:|.:.|.|.:.|||:
  Fly    14 ASLPTWVEKKELEALVK-QISEFRKIESLRWKWETQLAEP----ALCVHIQVLVADNKKRQVSYL 73

  Fly    69 VKLPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFGAKNYDLKNAKTDYVALE 133
            :|.|..| .:...:.||..|..||.|:..|:|.||.||:.....:.||......| .|:.::..:
  Fly    74 IKSPETV-PVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAK-LKSSHIYGD 136

  Fly   134 DLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVA-TKG---PYPKILLQGFFKEESRPV 194
            .:..||:..||.|:||.....|.||.||:.:||.:|..:| |.|   ..||:.......||:.. 
  Fly   137 YILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSDEETAE- 200

  Fly   195 MSEMIKGMGANFVKSCATYEGHEA--------YLDKVKALQPVAIDKIFEFAKV------EPTEF 245
                        :||......||:        |.||||:.|        ::.|.      ..|.|
  Fly   201 ------------LKSLYQLRFHESLRSNDARQYEDKVKSFQ--------KYVKSGTEILDSKTSF 245

  Fly   246 NVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAKFDYYIK 310
            ||:.:|..|.||::.|.||||.:|:.....:...:||....||...||  |...:|.::||.|:|
  Fly   246 NVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLL--TAPAEKSSRFDGYVK 308

  Fly   311 IYHDNLVEHLKILKYSKPIPSLRDIHLALFKYGYFGYTVATGVMSAVLLDPTDSASLENFIGGSD 375
            .|||.|:|:|.:||:....|||.|:.|.|.|||::.:..||.::..||.|          .|.:|
  Fly   309 FYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSD----------FGNND 363

  Fly   376 FQMQLYNSPRYRKHIQAVMPWLLNRGALE 404
            .: :|:.:|.:.:.|:.::||:.|||..|
  Fly   364 IE-ELFRNPVFGEQIRELLPWMENRGYFE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 95/301 (32%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 93/291 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.