DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and CG13658

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:422 Identity:105/422 - (24%)
Similarity:178/422 - (42%) Gaps:77/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PDWVTAEIFEDLLKANVDGYSK-----IKNFKADIGSAAGENYATIMLRVKIEVELQDGKSKSVS 66
            |.|:.||:.|..|:|    |.|     :.:.|....:..|::||::|.|.........|......
  Fly    18 PAWLNAELIEGALRA----YEKDPELHVTDLKISPATLQGDHYASVMFRAVSHYSTAKGNFSKAL 78

  Fly    67 YMVKLPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFGAKNYDLKNAKTDYVA 131
            .:..:|.|....::|:..:.||:.|..||::.:||||.:.:..| |.|   |.|    |...|.:
  Fly    79 IVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAG-DTT---KLY----APCIYHS 135

  Fly   132 L--------EDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKILLQGFFK 188
            |        |||..:|: ...|....::|..::...||::||||| ::|..:.|       .|.|
  Fly   136 LEPHQVMIFEDLVPQGY-TVIRDRYPNKEELQKAFFKLAKWHAAS-MKVLNERP-------DFLK 191

  Fly   189 EESRPVMSEMIKGMGANFVKSCATYEG----------------HEAYLDKVKALQPVAIDKIFEF 237
            |     ....:.|| .||:.......|                ::.|.:|:|......:..:.|.
  Fly   192 E-----FKYGLWGM-PNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEE 250

  Fly   238 AKV--EPTEFNVLNHGDSWSNNIMFQYD-AFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLE 299
            .:.  :|..:.||.|||....|:||:|: ..|..::|.|||:|:.....::.||:|.:......|
  Fly   251 YRTNPKPNRYYVLCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISNVCPLSIDLIYSIFMVMDTE 315

  Fly   300 DKLAKFDYYIKIYHDNLVEHLKILKYSKPIPSLRDI--HLALFK-YGYFGYTVATGVMSAV---- 357
            |:......||..|...|.:.||.:.:...:|:...:  |:...| |.:|..|....:::|:    
  Fly   316 DRWDLGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKT 380

  Fly   358 ------LLDP---TDSASLENFIGGSDFQMQL 380
                  ..||   ..|..|:.:|  :|.:|.|
  Fly   381 FKSMDSFFDPQTKQKSFFLDEYI--TDVKMLL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 80/310 (26%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 80/311 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459792
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.