DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and CG33510

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:362 Identity:81/362 - (22%)
Similarity:150/362 - (41%) Gaps:41/362 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EVELQDGKSKSVS--YMVKLPHQVEAIQEMMKRTNIFEIERTMYNEVVPELEALYKAVGVDITFG 116
            :.:|:|.|....|  ::..:..|...::..|::..:.|.|..:| :::.||:...|.|     :.
  Fly    65 QYQLEDQKDVQTSRLFVKSVIFQNANMEFYMEKMGLIEKEIKLY-DLLNELKKFSKHV-----WS 123

  Fly   117 AKNYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKI 181
            ||.|..:........:||:|........|.  |::.....:|:.|:..||:|......:|....:
  Fly   124 AKCYFTRKDLFVMQNVEDMGYVALPPGTRF--LNENQMGPILKSLATLHASSIAYEKQQGKTIGV 186

  Fly   182 LLQGFFKEES-RPVMSEMIKGMGANFVKSCATYEGHEAYLDKVKALQ------PVAIDKIFEFAK 239
            ..:.:.||.| .|.:.....|:.|  |.:.|..  |...||..:|.:      |..:||::....
  Fly   187 EFRKWLKEVSVDPEVEWYTTGLRA--VLAVAAI--HPDVLDNPEAQEYIAQELPRCLDKVYCMVN 247

  Fly   240 VEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLE--DKL 302
            ..|...||..|.|:|:.|:.:..:...:.:.: |||:||.:|...|.|  :.|::...||  .:.
  Fly   248 PSPVHRNVFVHRDAWNANVFYHKEKPHEERSI-LVDFQLCRYSPPAMD--FHLVTYLNLEPFSRK 309

  Fly   303 AKFDYYIKIYHDNLVEHLK---ILKYSKPIPSLRDIHLALFKYGYFGYT---VATGVMSAV---- 357
            ......|:.|:|.|.|..:   :..|.:.: |.::...:|..:..||.|   :|..|:...    
  Fly   310 KMIGSLIETYYDALAEEFREMGVNPYQEQL-SKQEFEQSLNDFSLFGATYNCIAATVLRLPDNYL 373

  Fly   358 --LLD--PTDSASLENFIGGSDFQMQLYNSPRYRKHI 390
              |.|  |.|.....|....:|....:.|.|.:..::
  Fly   374 KNLKDERPEDFHRFCNVDRSADVLRLMKNHPEFADYM 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 65/284 (23%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 49/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.