DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and CG33511

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:331 Identity:84/331 - (25%)
Similarity:145/331 - (43%) Gaps:56/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLKANVDGYSKIKNFKADIGSAAGENYATIMLRVKIEVELQDGKSK-SVSYMVK-LPHQVEAIQE 80
            |:.:.||..||      |:....||.|     ::.:|.|::..|.| .::|.:| ||.:.|..:|
  Fly    27 LINSQVDAGSK------DLMGYMGEYY-----KLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQRE 80

  Fly    81 MMKRTNIFEIERTMYNEVVPELE-----ALYKAVGVDITFGAKNYDLKNAKTDYVALEDLGLKGF 140
            ..:|..:|:.|..:|::::|:::     .||          .|.|..:|   |.:.|||| .:.:
  Fly    81 ECERKGVFQKESALYSQILPKIQKYATKKLY----------PKCYYSRN---DILVLEDL-TQDY 131

  Fly   141 KNANRLEGLDQEHTERVLRKLSQWHAASAV-----RVATKGPYPKILLQGFFKEESRPVMSEMIK 200
            ::....|....:|.:.||..||:.||||..     .|.....|..:|::......:    |..|.
  Fly   132 RHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDSNN----SWYIT 192

  Fly   201 GMGANFVKSCATYEGHEAYLDKVKALQPVAIDKIF-------EFAKVEPTEFNVLNHGDSWSNNI 258
            |:     |:.........:...:|| |....||::       |......|..|||.|.|:|.:||
  Fly   193 GL-----KAIVFLAARNPHFQTMKA-QNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNI 251

  Fly   259 MFQYDAFGKI--KEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAKFDYYIKIYHDNLVEHLK 321
            ::.::....:  ....:||:||.:|.:...|:|:.|......|.:.|.:|..::.|:.||..||.
  Fly   252 VYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLD 316

  Fly   322 ILKYSK 327
            .|...|
  Fly   317 RLGLDK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 77/304 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 76/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.