DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and CG31974

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:345 Identity:88/345 - (25%)
Similarity:149/345 - (43%) Gaps:76/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GENYATIMLRVKIEVELQDGKSKSVSYMVKLPHQVEAIQEMMKRTN-----IFEIERT------M 94
            |:||.:|||.|:.::...||..:.:..:.|||          ..||     ||:.|||      :
  Fly    36 GDNYGSIMLSVQAKIRSADGGIRDLPLIAKLP----------PLTNDLYWQIFQPERTCITENAV 90

  Fly    95 YNEVVPELEALYKAVGV---DITFGAKNY-------DLKNAKTDYVAL---EDLGLKGFKNANRL 146
            |..:.|||:.|....|:   .|..|...|       |.:..|.|..|:   |::..:|::..||.
  Fly    91 YQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAVLVQENVTTRGYRPGNRH 155

  Fly   147 EGLDQEHTERVLRKLSQWHAASAVRVATKGPYPKILLQGFFKEESRPVMSEM----------IKG 201
            ...:...|..:|..|:|:|   |:.:|.:...|::     ::|..||...:.          .:.
  Fly   156 RPYNLAETVLILHYLAQYH---ALPIALRLKKPQV-----YEEYVRPYFKKFDMNSNIDQAETEI 212

  Fly   202 MGANFVKSCATYEGHEAYLDKVKALQPVAIDKIFEFAK-VEPTEFNVLNHGDSWSNNIMFQYDAF 265
            |....:|........|..:::||.|  :.|.:.|:.:. |:...|..|.|||.|.||:|.:|...
  Fly   213 MNKEILKDIKLVTSDERDVNRVKEL--LDIFQAFQASNDVDDGPFTTLVHGDLWINNMMLKYGMR 275

  Fly   266 G------KIKEVYLVDYQLPKYGTVAQDLLYFLLSSTKLEDKLAKFDYYIKIYHDNLVEHLKILK 324
            |      |:|   :||:|:.:||::..|:::.|.||..           :.:..||....|.|. 
  Fly   276 GEEGTPLKVK---IVDFQIAQYGSLVHDIIFVLFSSVD-----------VNVLEDNFYNFLTIY- 325

  Fly   325 YSKPIPSLRDIHLALFKYGY 344
            |:..|.:||.:::....|.|
  Fly   326 YNAFIQTLRSVNVDTSNYTY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 82/324 (25%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 86/335 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459629
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.