DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and C29F7.1

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:351 Identity:75/351 - (21%)
Similarity:133/351 - (37%) Gaps:69/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KNFKADIGSAA--GENYATIMLRVKIEVELQDGKSKSVSYMVKLPHQVEAIQEMMKRTNIFEIER 92
            ||....|.|.|  ||...::.:.|        .|..:.:.|....|..|.        |.:.:.|
 Worm    67 KNVVIKIASCAKLGEGVGSVGVDV--------NKGNAAAIMELFMHNTEC--------NYYNVFR 115

  Fly    93 TMYNEVVPELEALYKAVGVDITFGAKNYDLKNAKTDYVALE--------DLGLKGFKNANRLEGL 149
             .|.::..::..:|.|        ||..|.: |....:.:|        ||          ::|.
 Worm   116 -KYTDLPMKVPVIYCA--------AKAGDAE-APVPVIVMEMFEDCTVHDL----------IDGF 160

  Fly   150 DQEHTERVLRKLSQWHAASAVRVATKGPYPKILLQGFFKEESRPVMSEMIKGMGANFVKSCATYE 214
            |::...:::.::...|..|......:...|...::     ::..:...|:|.:..|..||    .
 Worm   161 DKDQLFKIVDEIVNLHIFSLTTEEWRSVLPDSAMR-----DTVDLFEAMVKTIAENMAKS----P 216

  Fly   215 GHE---AYLDKVKALQPVAIDKIFEFAKVEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDY 276
            |.|   .|::|.....|..:.| |....:|....:||.|||.||..|::..|.    ....::|:
 Worm   217 GLEIISKYIEKTFDKDPSFMTK-FSDEYLEGKRKSVLTHGDLWSPQILWDKDD----NIAGIIDW 276

  Fly   277 QLPKYGTVAQDLLYFLLSSTKLE--DKLAK--FDYYIKIYHDNLVEHLKILKYSKPIPSLRDIHL 337
            |:...|:..:||...|.:.|.:|  :||.|  .|:|.:.....|.|  |.:|.......:.:.:.
 Worm   277 QVGHQGSPMEDLHRILSTGTSVENRNKLTKPLLDHYFEKLSAGLEE--KGVKMPWTREEVDEEYN 339

  Fly   338 ALFKYGYFGYTVATGVMSAVLLDPTD 363
            ..|.||......:.|:.|:..:..||
 Worm   340 HCFSYGASITIFSNGIWSSSPILQTD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 62/298 (21%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.