DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10562 and F59B1.8

DIOPT Version :9

Sequence 1:NP_651385.3 Gene:CG10562 / 43066 FlyBaseID:FBgn0039326 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:359 Identity:76/359 - (21%)
Similarity:148/359 - (41%) Gaps:78/359 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IMLRVKIEVELQD--GKSKSVSYMVKLPHQ---VEA-IQEMMKRTNIFEIERTMYNEVVPELEAL 105
            ::|::...|.:|.  .||......|..|.:   |.| .::..::.:..|:|   :.|....||.|
 Worm    76 LILKIVSFVHVQGLLNKSNEEGNSVMSPEEEAHVHAHFEKSCQKGHNLEVE---FCEAFGHLEGL 137

  Fly   106 YKAVGVDITFGAKNYDLKNAKTDYVALEDLGLKGFKNANRLEGLDQEHTERVLRKLSQWHAAS-- 168
            .    :...|.::.::..|....:|.:|  .::|....:..|.:..:..:.:|:.|::..|.|  
 Worm   138 L----LPKVFFSQKFEEDNPNKGFVGME--FVEGSVVRHCYENVTVDELQPILKALARLQALSLS 196

  Fly   169 --AVRVATKG-PYPKIL--------LQGFFKEESRPV---MSEMIKGMGANFVKSCATYEGHEAY 219
              :.|....| .:.:.|        |:|.| ::||.:   :||.::.:..|          |:..
 Worm   197 TESCRNLDNGEAFEESLMDMLSEDGLKGIF-DQSRNIDQKLSEKVERIEQN----------HKEI 250

  Fly   220 LDKVKALQPVAIDKIFEFAKVEPTEFNVLNHGDSWSNNIMFQYDAFGKIKEVYLVDYQLPKYGTV 284
            |:         ::.:....||...:..|:.|||.|:.||::.....|.|.:..| |||....|..
 Worm   251 LN---------LETVLNLNKVVGIDQKVICHGDLWAANILWTQTDGGFIADKVL-DYQESHMGNP 305

  Fly   285 AQDLLYFLLSSTKLEDKLAKFDYYIKIYH----DNL--------VEHLKI-LKYSKPIPSLRDIH 336
            |:||:..|:|:....|:.:.:::.::.::    |.:        :|.||. .|...|:.:|..|.
 Worm   306 AEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIGSNNAPYTLEQLKTSFKLYFPVGALTLIS 370

  Fly   337 LALFKYGYFGYTVATGVMSAVLLDPTDSASLENF 370
            |       ||..|      .:.|...:|...||:
 Worm   371 L-------FGPAV------DMKLQGMESGKAENY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10562NP_651385.3 EcKinase 41..325 CDD:281023 64/312 (21%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 76/359 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.