DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and pkdc

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:261 Identity:57/261 - (21%)
Similarity:86/261 - (32%) Gaps:95/261 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ENYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLK-------GPYEEKYTN 194
            |..::||||...||.  .|...::.|..::.|...|.:|   |:.:|:.       |.|....|.
Zfish   107 EQLIVLEDLDVAGFP--VRKTYVNDAEIKACLSWIANFH---ALFLDVTPEGLWPIGTYWHLETR 166

  Fly   195 GFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHG 259
                 .|.:....|:..|.....||                    .|.|:.:      |..:.||
Zfish   167 -----PEELEAMSDQKLKAAAGEID--------------------SILNNCR------FKTIVHG 200

  Fly   260 DGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEK-----FDYFVWF 319
            |....|..|. .|..::::   ||.|....|...:|:.|| |.|...:.:.||     .||    
Zfish   201 DAKLANFCFS-KDGLQVAS---VDFQYVGGGCGMKDVIYF-LGSCMDERECEKKAPGLLDY---- 256

  Fly   320 YHSELVK------------------------------------HLKLLNYSKKL--PTLRSIRNA 346
            |.|||.|                                    |.|:..|||:|  ..|:.::.:
Zfish   257 YFSELRKSLEKKVDFAELEKEWRNMFAFAWTDFHRFLLGWMPGHHKINKYSKRLTQEVLKKLKQS 321

  Fly   347 L 347
            |
Zfish   322 L 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 51/243 (21%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 49/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.