Sequence 1: | NP_651384.2 | Gene: | CG10560 / 43065 | FlyBaseID: | FBgn0039325 | Length: | 414 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001335286.1 | Gene: | pkdc / 797003 | ZFINID: | ZDB-GENE-041111-115 | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 57/261 - (21%) |
---|---|---|---|
Similarity: | 86/261 - (32%) | Gaps: | 95/261 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 ENYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLK-------GPYEEKYTN 194
Fly 195 GFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHG 259
Fly 260 DGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEK-----FDYFVWF 319
Fly 320 YHSELVK------------------------------------HLKLLNYSKKL--PTLRSIRNA 346
Fly 347 L 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10560 | NP_651384.2 | EcKinase | 52..333 | CDD:281023 | 51/243 (21%) |
pkdc | XP_001335286.1 | PKc_like | <96..267 | CDD:304357 | 49/204 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589365 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |