DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG31370

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:383 Identity:86/383 - (22%)
Similarity:174/383 - (45%) Gaps:36/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EVPIPGWVKPEVFEDLLKDNVK--DYKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVTK 76
            ::.:|.|:..:...|:|:.:.|  |.:.|| |....|.|.|:|||::::|..::..|: |...:|
  Fly     9 QLNVPEWLNEQFVTDVLRSHEKEPDLRVTK-LDFTPGSAKGDNYASVIIRARVEYITQ-KGFFSK 71

  Fly    77 AFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEA--YEIKVSENY 139
            :.::||      ..::...:.:|..|.|||..|:||..::.|:.....:..||.  |.::.|: .
  Fly    72 SLIIKT------VLEMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAECIYYSLEPSQ-V 129

  Fly   140 VLLEDLRPRGFKNV-DRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGF------F 197
            ::.|||....:..| ||:  |..........|.|::||.|...::.:..:.:::.:|.      :
  Fly   130 MIFEDLGEMDYAMVRDRV--LTHGEICGAYSKLAKFHALSMKIINERPEFVKEFKDGICLVDIPY 192

  Fly   198 KSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQ-SVSEKLFDIYNDIKEPKSDEFNALNHGDG 261
            .|..:..|      |..|..|.:.|.:..:.:.:: ...::|.||..:.:......:..|.|||.
  Fly   193 MSSGMGPF------KDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDY 251

  Fly   262 WSNNIMFQYN-DKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELV 325
            .:.|||.::| :.....:...:|.|......:|.||.|.:....:.:.:..:.:..:.:|.|.|.
  Fly   252 HTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLR 316

  Fly   326 KHLKLLNYSKKLPTLRSIRNALNKYSGWAFI-----CSISVMGVVLLDPTDDADFDKI 378
            :.|:.:.|..|||...:....:.:...:.|:     ..:|| |:.|...|::...||:
  Fly   317 ETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPMSV-GLSLETATNEETDDKL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 63/291 (22%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 63/292 (22%)
APH <202..320 CDD:279908 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.