DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG31104

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:355 Identity:91/355 - (25%)
Similarity:165/355 - (46%) Gaps:26/355 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EVPIPGWVKPEVFEDLLK--DNVKDYKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVTK 76
            |:..|.|:..:...|:|:  :.:.|.|.|. |:.....|.|::||::|.|.:::. |..|.:..|
  Fly    12 ELQAPAWLNAQFIGDILREYEQLPDLKVTD-LQVSPATAQGDHYASVMFRTKVEY-TTPKGKFFK 74

  Fly    77 AFMLKTPHDTDAYRK-LLQETNIFDVERGMYLVVVPELEQMYRDVGLEVK-FGAEAYEIKVSENY 139
            ..::||..:.:.::| :|.|:::|:.|.|||...:||.|::.|:.|...| |....|........
  Fly    75 PLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAGDNTKLFVPCIYHSLKPRQV 139

  Fly   140 VLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKEI-- 202
            ::.|||.|:|: .|.|.........:....|.|:|||.|...::.:..:.:::..|.|:...|  
  Fly   140 MIFEDLVPQGY-TVIRDSPPSLGDLKLAFDKLAKWHAVSMKVINEQPYFLKEFQYGLFEMPTIDT 203

  Fly   203 -------MNFFCDRSAKILLNNIDQYDGHAAYIKD--LQSVSEKLFDIYNDIKEPKSDEFNALNH 258
                   |..|.:...|  :..:.:|..|...|||  :|.:..::.:.:   |..::|.:..|.|
  Fly   204 DPFITTGMTNFIEMLDK--MPELRKYKHHFEKIKDNYMQRLEVEMHEYH---KYRRNDRYYVLCH 263

  Fly   259 GDGWSNNIMFQYN-DKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHS 322
            ||....|:||::| :.....:...||.||.....:..||.|.:......:.:.|..:..:..|.|
  Fly   264 GDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGENLINEYFS 328

  Fly   323 ELVKHLKLLNYSKKLPTLRSIRNAL--NKY 350
            .||..|:.:.|...:||.|.:...:  |||
  Fly   329 VLVATLRKIGYKGDMPTQRELWEQIQNNKY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 74/294 (25%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 74/295 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.