DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG14314

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:411 Identity:94/411 - (22%)
Similarity:161/411 - (39%) Gaps:90/411 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EVFEDLLKDNVKDYKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVTKAFMLKTPHDTDA 88
            |||:|:.| :|:...:..|.....|...|:||...:.|::|..:.:.............|....|
  Fly    29 EVFQDIFK-HVEPDVQIDAFELAQGSDRGDNYTAALYRIKLTGKRRSLKWEQNVICKVMPESVVA 92

  Fly    89 YRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGA--------------EAYEIKVSENY 139
             |:..:...:|..|...|..::|||          :||.|              :.|..:  .:.
  Fly    93 -REAYKSDKLFRNEVQFYNTIMPEL----------LKFQASKTNQDTPVFNAIPKCYSAR--HDL 144

  Fly   140 VLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKEIMN 204
            :::||||.|||:..||.:||....|:|||.:.||.|..|..       |:      |.|..|..|
  Fly   145 LIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLA-------YK------FEKPLEFSN 196

  Fly   205 --------FFCDRSAKILLNNIDQYDGHAAYIKDLQSVSE------KLFDIYNDIKEPKS----- 250
                    .||..:.....|..::...:|     :|.|||      |.....|...|..|     
  Fly   197 LCSMISEGIFCTANTSWYRNYYERLTKNA-----IQMVSEVLPPDSKYVLAMNKFAESSSFFGRM 256

  Fly   251 -------DEFNALNHGDGWSNNIMFQYN--DKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSL 306
                   ...:|:.|||.|.||.::.|:  |.:.:.....:|.||.::.|:|.|:...|...|:.
  Fly   257 VKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTK 321

  Fly   307 DIKTEKFDYFVWFYHSELVKHLKLL--NYSKKLPTLRSIRN----ALNKYSGWAFICSISVMGV- 364
            :::..:....:..|..||.:.|::|  |......||:.:::    .|..|..:|...::.::.: 
  Fly   322 EMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKLQDLFAEELKTYGRFALGLALDILPIS 386

  Fly   365 ---------VLLDPTDDADFD 376
                     :.||.:|:...|
  Fly   387 TCSSEDAPDMYLDRSDELGED 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 76/324 (23%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 75/320 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.