DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG6830

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:427 Identity:158/427 - (37%)
Similarity:246/427 - (57%) Gaps:17/427 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PPQTNDENVCEREVPIPGWVKPEVFEDLLKDNVKDYKKTKALRAKAGVAAGENYATIMLRLELDV 66
            ||...:..|...:: :|.|:....||:||..:|..:.|....|.|..:|.||||||:|||:.:||
  Fly    32 PPNKPEPEVDHSDL-VPKWLNQTQFEELLAADVDQFSKIVGFRVKPAMAPGENYATLMLRISIDV 95

  Fly    67 ETKDKSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAY 131
            |..|||....:||:|.||||....:::...|.|..|...|..::|::|::|:..||::||...|:
  Fly    96 ELTDKSTKLVSFMMKVPHDTPQMEQMMSMANFFTSENAAYTEILPKMEELYKAKGLDIKFAPRAF 160

  Fly   132 EIKVSE-----NYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEK 191
            ::..::     |.||:.||...||||::||:.|:...|:..|.:.||:|||.|..|.:.|||.:.
  Fly   161 KLDATKEPKVANTVLMHDLGQNGFKNINRLECLNLEQTKFALTRLAQFHAAGATMVQVHGPYPDI 225

  Fly   192 YTNGFF-KSKEIMNFFCD------RSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPK 249
            :.||.. .:||.:..|.:      |::  .:.|:|::.....|.:.|:.....|...:..:....
  Fly   226 FVNGVMGNNKEAIIAFMEGMLASFRTS--FMANLDKFKNGEEYREKLEKALAGLTMEFMKLGIVD 288

  Fly   250 SDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFD 314
            .:|||||||||.|.||::|:.|...::.:..|||.|.||:||.|.||.||::||..:|.|...||
  Fly   289 PNEFNALNHGDCWMNNLLFKMNSSGDLEDMVFVDFQNPKYGSPAMDLLYFIISSVQIDYKLSHFD 353

  Fly   315 YFVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKII 379
            :|:..|...|||||.:|.::.:.|:||.:...|.||.||....:|||:.:||||||..|.||..:
  Fly   354 FFIRHYQEALVKHLGILGFTGRKPSLRELHRTLIKYGGWVLFPTISVLPLVLLDPTQSATFDNFM 418

  Fly   380 SN--EHSNFTNSIYTNPRYRRHMKVVLPWLQHRGALE 414
            |:  :..:|..|:|.|.|.:.:::.:||||.:||.||
  Fly   419 SDSADGVSFRGSLYANKRCQEYIERILPWLDNRGFLE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 110/292 (38%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023 110/293 (38%)
EcKinase 516..800 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442525
Domainoid 1 1.000 57 1.000 Domainoid score I17979
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101022at50557
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.