DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and F59B1.10

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:264 Identity:59/264 - (22%)
Similarity:100/264 - (37%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSEN-----------YVLLEDLRP-RGFKN 152
            :||..||.......::|:..   |:.|    ||:....|           |..|::... :||..
 Worm   104 EVEEQMYAYFESSCKKMHNQ---EMNF----YEVAGKFNSKTLLIPKVYFYTKLDEKNSNKGFIG 161

  Fly   153 VDRLQGLDQAHT---------ESVLRKFAQWHAASAVRVDLKGPYE-----EKYTNGFFKSKEIM 203
            ::.::|....|:         :.:||..|:..|.|     |:.|.|     :|..||....:.:.
 Worm   162 MEYVEGSIVRHSYDTCTIEEIQPILRAIAKLQALS-----LQNPAEISKDLQKIDNGAIFQETLK 221

  Fly   204 NFFCDRSAKILL------------NNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNAL 256
            ....:...|.:.            ..:|:.:.....|.|.    ||.|:: |.:...|.   |.|
 Worm   222 MMLSESGIKGIFEQCRNLERSRFGEKVDRIEEKRNEILDF----EKAFNL-NKVVGIKQ---NVL 278

  Fly   257 NHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSS-TSLD-------IKTEKF 313
            .|||.|:.|.::..|: .....|..||.|:...|:.|:||...|:|: |..|       |..:.:
 Worm   279 CHGDLWAANFLWTENN-GVFCATRIVDYQMSHLGNPAEDLVRLLVSTITGADRQAHWQQILEQFY 342

  Fly   314 DYFV 317
            .||:
 Worm   343 SYFL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 59/264 (22%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 59/264 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.