DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG33511

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:329 Identity:75/329 - (22%)
Similarity:136/329 - (41%) Gaps:40/329 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KKTKALRAKAGVAAGE----NYATIMLRLELDVETK-DKSEVTKAFMLKT-PHDTDAYRKLLQET 96
            ||...:...:.|.||.    .|.....:|.|:.|.| ||.:....:.:|: |...:..|:..:..
  Fly    21 KKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK 85

  Fly    97 NIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLLED---LRPRGFKNVDRLQG 158
            .:|..|..:|..::|:: |.|....|..|......:|.|.|:  |.:|   ||...:..:|    
  Fly    86 GVFQKESALYSQILPKI-QKYATKKLYPKCYYSRNDILVLED--LTQDYRHLRANEYYTLD---- 143

  Fly   159 LDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKE--IMNFFCDRSAKILLNNIDQY 221
                |.:.||...::.||||..       :|||.....::|.:  ::....|.:....:..:...
  Fly   144 ----HYKIVLEHLSELHAASIA-------WEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAI 197

  Fly   222 ------DGHAAYIKDLQSVSEKLFDIYNDIKE---PKSDEFNALNHGDGWSNNIMFQYNDKNEI- 276
                  :.|...:|....:.:||:::....:|   |.....|.|.|.|.|.:||::.:|.::.: 
  Fly   198 VFLAARNPHFQTMKAQNFIQDKLYNLLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVL 262

  Fly   277 -SNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSKKLPTL 340
             :....||.||.::.|...|:.:.|....|.:::...:|..:..|:..|..||..|...|.|.|.
  Fly   263 PNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITE 327

  Fly   341 RSIR 344
            .:.|
  Fly   328 NNFR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 67/302 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 65/295 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.