DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG7135

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:405 Identity:100/405 - (24%)
Similarity:173/405 - (42%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PGWVKPEVFEDLLKDNVKD-------YKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVT 75
            |.::.|:.|...|:..::.       .:.|...|      .||||.:.:.|.::.....:...:.
  Fly     9 PLYLTPQFFRRTLEHGLQQLDLQVIGVQLTNLTR------GGENYCSNIYRAQIKYRNAESCAME 67

  Fly    76 KAFMLKT-PHDTDAYRKLLQETNIFDVERGMYLVVVPELEQ-MYRDVGLEVKFGA------EAYE 132
            .:.::|: |.:..|   :|...:|::.|...|:.:.|:||. |:|.|.   .|.|      ..|.
  Fly    68 TSLIVKSMPDEKQA---ILARLHIYNKETLFYMHIKPKLEALMWRAVD---SFSAWTLAPKHYYS 126

  Fly   133 IKVSENYVLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGP--YEEKYTNG 195
            ....|..::||||...|::...|..|||..|...|:.|.|::||.:.|..: :.|  ..::|..|
  Fly   127 TTQPEQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAE-REPETIVDRYPFG 190

  Fly   196 FFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQ---SVSEKLFDIYNDIKE-------PKS 250
            ...    |:.......|:|...  |....||.:.|.:   .::.||:..:....|       |..
  Fly   191 LLH----MDAINSEPFKLLFGT--QLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVYPLR 249

  Fly   251 DEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDY 315
            ...|.|||||.|.|||.|:|:.:..:.....:|.||..:||:..|:.|||.:|..|::..::...
  Fly   250 GNHNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEVLRDRRQE 314

  Fly   316 FVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKIIS 380
            .|..|:..||..||.|.:||:||:...|.:.:.|...:.|..:.....::.:...|..|      
  Fly   315 LVDIYYRSLVDCLKHLPWSKELPSYEDIMDEIRKREAYGFFVAFGFFPLMSMIGVDSED------ 373

  Fly   381 NEHSNFTNSIYTNPR 395
            |...||.:..:...:
  Fly   374 NSLKNFHDETFARQK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 82/300 (27%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 81/299 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459246
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.