DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG31975

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:318 Identity:75/318 - (23%)
Similarity:135/318 - (42%) Gaps:32/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GENYATIMLRLELDVETKDKSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQM 116
            |:||.:::|.:...::..:.....:..:.|.|.....|.:..|.......|..:|.::.|.|..:
  Fly    37 GDNYGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPKYWQFFQPEQTCLTENAVYKILAPALATL 101

  Fly   117 YRDVGL--EVKF-----------GAEAYEIKVSENYVL-LEDLRPRGFKNVDRLQGLDQAHTESV 167
            ..:.|:  |.:|           ..|:...||.:|.|| ||:||..|:.:..||:..|.|||...
  Fly   102 QDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRLKAFDLAHTLLA 166

  Fly   168 LRKFAQWHAAS-AVRVDLKGPYEEKYTNGFFKS----------KEIMNFFCDRSAKILLNNIDQY 221
            |:..|::||.| |:|: |:.....:....|||.          |.:|........:...||    
  Fly   167 LKYMAEFHALSLALRI-LRPEVFREQVRPFFKKFDWHAEAPEWKSVMKAETLEDIRRATNN---- 226

  Fly   222 DGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQL 286
              .:..:..::.:|::.|:......:.....|.::.|.|.|.|||||:|...........:|.|.
  Fly   227 --DSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINNIMFRYGPTGTPVELKIIDFQT 289

  Fly   287 PKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSKKLPTLRSIR 344
            .::.||..|:..|||||....|...:|::.:..|:....:.|:.:....::.|.:..|
  Fly   290 AQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRRVGAKLEVHTFKEFR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 73/305 (24%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 73/304 (24%)
APH <214..329 CDD:279908 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459609
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4070
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.