DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG2004

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:161/395 - (40%) Gaps:60/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDLLKDNVKDYKKTKALRAKAGVAA--GENYATIMLRLEL-----DVETKDKSEVTKAFMLKTPH 84
            |..|.:.:::...|:....|.|.:.  |:.|.:.:.|:.:     ..|.:|:.::..:.::|...
  Fly    16 EATLDEIIRNAGGTRHTSYKFGPSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMP 80

  Fly    85 DTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRD--------------------------VGLE 123
            |....|:|.:....|..|...|..|:|.:|...:.                          :.||
  Fly    81 DNLHRRRLFRSVIFFRNEINFYTKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALE 145

  Fly   124 VKFGAEAYEIKVSENYVLLED----LRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDL 184
             ..|...|...|.::|:.|||    :|..|     |..|:..|......:.|.:  ||.::....
  Fly   146 -DVGPRGYRAPVRQDYISLEDALLTMRTLG-----RFHGVALAFNALDSKNFEK--AAGSLEETY 202

  Fly   185 KGPYEEKYTNGFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEPK 249
            .|.:..::..||....|  |...|...:|..|:  :|:..|.     ..:...|||...::...:
  Fly   203 YGEHTREWYTGFLLLAE--NVATDAVKQIYPNS--KYETVAT-----NFLQPPLFDDLINLVSTR 258

  Fly   250 SDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFD 314
            | :.:...|||.|:.|.:.:||::.:......:|.||.:..|:|.||.:|:.|.||.:::.:.:|
  Fly   259 S-KLSVFGHGDCWTPNFLTKYNERGQSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYD 322

  Fly   315 YFVWFY---HSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFD 376
            ..:..|   ..:|::.|.  ..::.:.:..|::..|..:..:.....|..:.:.:::..:.||.|
  Fly   323 ELLRAYLESAQDLIQDLG--GNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLD 385

  Fly   377 KIISN 381
            .|..|
  Fly   386 GIKEN 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 68/318 (21%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 67/315 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.