DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and CG33301

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:421 Identity:112/421 - (26%)
Similarity:189/421 - (44%) Gaps:40/421 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IPGWVKPEVFEDLLKDNVKDYKKTKALR--AKAGVAAGENYATIMLRLELDVETKDKSEVTKAFM 79
            :|.|:.....:..|:...:| .:.:.||  ||.....|||:..:|.|:.:|.:..|.|.|.|.::
  Fly     2 LPTWLTAAYLQPRLRAYCQD-DRLQVLRIWAKPATGKGENFVGVMTRIYVDYQLGDGSVVNKTYI 65

  Fly    80 LKTPHDTDA-YRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLLE 143
            :|.....:. ..::..|..::..|..||..::|:|:::.::.||:.|..|:|..:....|.::||
  Fly    66 VKQALSAEVPQAEVFFEYELYTREMDMYEFILPKLKELLQEAGLDQKLTADAITVDREYNTMILE 130

  Fly   144 DLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEK---------YTNGFFKS 199
            ||.|..|.|.||::.||.||||..|...|::||||.|       .:|:         ||:.|.:.
  Fly   131 DLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIV-------LQERHPNLLTKCFYTHFFSRD 188

  Fly   200 KEIMNFFCDRSAKILLNNID-QYDGHAAYIKDLQSVSEKLFDIYNDIKEPKSDEFNALNHGDGWS 263
            |:..:.......|..|..|| |.:...||...|..:...:.:......:....:...|||||.|:
  Fly   189 KKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLNHGDCWT 253

  Fly   264 NNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKH- 327
            .||||||:|..|..:...:|.|.....|...||:||..:|...::..::         ||||:| 
  Fly   254 TNIMFQYDDAGEPRSVVAIDFQFSNCTSPTIDLHYFFTTSLREEVGDKE---------SELVEHH 309

  Fly   328 -------LKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKII--SNEH 383
                   |:..:|...||||:..|....:....:.:..:....::.....:.:||..:.  |.|.
  Fly   310 YKALKANLEKFSYKGSLPTLQEYRLQFERRRFMSLLAHMFKPCMIYNGSEETSDFSSLYAESPEG 374

  Fly   384 SNFTNSIYTNPRYRRHMKVVLPWLQHRGALE 414
            ..:..|:|.:....|....:|..|..:|.||
  Fly   375 LRYQKSVYASEAVIRSATKLLAILDAKGLLE 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 86/299 (29%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 86/300 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.