DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and Y45G12C.4

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_503696.1 Gene:Y45G12C.4 / 189933 WormBaseID:WBGene00021567 Length:431 Species:Caenorhabditis elegans


Alignment Length:292 Identity:63/292 - (21%)
Similarity:100/292 - (34%) Gaps:85/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENY 139
            |||:.||...|.            ||::..|.|..||.:..|            ..||...:::.
 Worm   148 TKAYYLKPFKDK------------FDLKGFMILDFVPNVHPM------------PMYESIPADDL 188

  Fly   140 VLLEDLRPRGFKNVDRLQGLDQAHTESVL---RKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKE 201
            :.|       .:.|....|    |.||:.   |.||:......:.      :||.|.        
 Worm   189 ISL-------VRGVATFAG----HGESLTAEQRSFARGSDIFELM------FEEMYP-------- 228

  Fly   202 IMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSE--KLFDIY-NDIKE-PKSDEF----NALNH 258
                  |...:.:...|....|    .|:...|.|  |||.|| |.||. .|..|.    ..|||
 Worm   229 ------DEQLERVCGVIQATFG----AKNPAVVEECIKLFWIYKNSIKSYSKVSELLGFKLVLNH 283

  Fly   259 GDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQ-----DLYYFLLSSTSLDIKTEKFDYFVW 318
            ||.|.:|::...::...:.....:|     |..|:.     ||...|:...:...:.|:....:.
 Worm   284 GDLWQSNMLHCLDEHGNLVLKAIID-----WQGVSMLPPGLDLARLLMGCLTAYERRERGAELLM 343

  Fly   319 FYHSELVKHLKLLNYSKKLPTLRSIRNALNKY 350
            .||......:     .::|.:|..::::.|.|
 Worm   344 LYHQTFTGIV-----GEELFSLEELQDSYNLY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 59/273 (22%)
Y45G12C.4NP_503696.1 DUF1679 16..422 CDD:369592 63/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8086
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.