DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and H37A05.2

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:312 Identity:63/312 - (20%)
Similarity:121/312 - (38%) Gaps:85/312 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYATIMLRLELDVETKDKSEVTKAFMLKTPH--DTDAYRKLLQE------TNIFDVER------- 103
            |::|::.....|:| |.||..:   ::|..|  :.|.||.:::|      .|:..:|.       
 Worm    88 NFSTLVSSETWDIE-KMKSMTS---LVKELHNREVDMYRIIMREKPACPTVNVLSLEAFTELSPL 148

  Fly   104 GMYLV--VVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLLEDLRPRGFKNVDRLQGLDQAHTES 166
            ..|::  .:|.|..    ||:...       |.:.|.:.:::.:.                    
 Worm   149 KAYIISEYIPNLHH----VGMNDC-------ISIEEIWAVVDGIA-------------------- 182

  Fly   167 VLRKFAQWHAASAVRVDLKGPYEEKYTNG-FFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKD 230
                     |.||:...:....::|.|.| .:..:.:..||.|:|...:..|:....| .||.:.
 Worm   183 ---------AFSAMGESMSEDEKKKSTIGEIYIEEAVKYFFDDQSPDNMRKNLIMILG-VAYEEK 237

  Fly   231 LQSVSEKLFDIY---NDIKEPKS------DEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQL 286
            ::...: :||:|   ::|::..|      .....|.|.|.|.:|::|..:.:|::.....:|.|.
 Worm   238 VEEAMD-IFDLYCGSSEIQKNYSRVSAFLGHSPVLMHSDIWPSNLLFSLSSENKLEFKALIDFQT 301

  Fly   287 PKWGSVAQDLYYFLLSSTSLD------IKTEKFDYFVWFYHSELVKHLKLLN 332
            ....|...|:  ..|:.|.|.      :::|..|.    |:...||.||..|
 Worm   302 ASLSSPGLDV--GCLTVTCLSKKDRRTVQSEILDR----YYKSFVKSLKTPN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 63/312 (20%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 63/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.