DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and H06H21.8

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:244 Identity:52/244 - (21%)
Similarity:99/244 - (40%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 VLLEDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRVDLKGPYEEKYTNGFFKSKEIMN 204
            ::.|:|..:.|. |:.:.||.......::...|..|:....|.|      :.|...|.:......
 Worm   129 IVAENLSEKVFA-VEHIPGLKHEQILRLMEALAGLHSFLMKRDD------KSYVESFVEGAHGRE 186

  Fly   205 FFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLF--DIYNDIK---------EPKSDEFNA--- 255
            .|.:....::...          ...|::||.::|  |...:||         :..:|..:|   
 Worm   187 TFSEGMQNMMFEE----------ALTLENVSPEVFGNDRIRNIKWSFDYSIKNKATADAISAFPG 241

  Fly   256 -LNHGDGWSNNIMFQYND-KNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVW 318
             :.|.|....|::::.:. |:|||  ..:|.|:...||:|.|:...|....:.:|:.:....::.
 Worm   242 IICHADLNVTNVLWKKDSAKDEIS--AIIDYQMLFIGSIAFDIIRVLTLGLNREIRRKMTQNYLD 304

  Fly   319 FYHSELVKHLKLLNYSKKLPTLRSIRNALNKYS-GWAFICSISVMGVVL 366
            .||..|.   :|.|  .|.|.  |:...|::|| .:.|..:.|:.|:.|
 Worm   305 HYHKTLT---ELSN--GKAPF--SMEELLHQYSLIYPFSSNFSLFGIAL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 41/208 (20%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 40/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.