DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10560 and C29F7.1

DIOPT Version :9

Sequence 1:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:325 Identity:73/325 - (22%)
Similarity:125/325 - (38%) Gaps:117/325 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 AKAGVAAGENYATIMLRLELDVETKDKSEVTKAFMLKTPHDTDAYRKLLQETNIFDVERGMYLVV 109
            ||.|...|.        :.:||...:.:.:.:.||    |:|        |.|.::|.|      
 Worm    77 AKLGEGVGS--------VGVDVNKGNAAAIMELFM----HNT--------ECNYYNVFR------ 115

  Fly   110 VPELEQMYRDVGLEVKF---GAEAYEIKVSENYVLLE--------DL-----RPRGFKNVDRLQG 158
                  .|.|:.::|..   .|:|.:.:.....:::|        ||     :.:.||.||.:..
 Worm   116 ------KYTDLPMKVPVIYCAAKAGDAEAPVPVIVMEMFEDCTVHDLIDGFDKDQLFKIVDEIVN 174

  Fly   159 LDQAHTESVLRKFAQWHAA---SAVR--VDLKGPYEEKYTNGFFKSKEIMNFFCDRSAKILLNNI 218
            |   |..|:..:  :|.:.   ||:|  |||                      .:...|.:..|:
 Worm   175 L---HIFSLTTE--EWRSVLPDSAMRDTVDL----------------------FEAMVKTIAENM 212

  Fly   219 DQYDGHAAYIKDLQSVSEKLFDIYNDIKEPK-----SDEF------NALNHGDGWSNNIMFQYND 272
            .:..|    ::.:....||.||     |:|.     |||:      :.|.|||.||..|::..:|
 Worm   213 AKSPG----LEIISKYIEKTFD-----KDPSFMTKFSDEYLEGKRKSVLTHGDLWSPQILWDKDD 268

  Fly   273 KNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKFDYFVWFYHSELVKHLKLLNYSKKL 337
              .|:.  .:|.|:...||..:||:..|.:.||::.:            ::|.|.| |.:|.:||
 Worm   269 --NIAG--IIDWQVGHQGSPMEDLHRILSTGTSVENR------------NKLTKPL-LDHYFEKL 316

  Fly   338  337
             Worm   317  316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 67/312 (21%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.