DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10553 and CG18765

DIOPT Version :9

Sequence 1:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:416 Identity:108/416 - (25%)
Similarity:196/416 - (47%) Gaps:50/416 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KQVTIPDWVKPTVFEELLKRIVKDYKATKSMRANAGVAAGENYATVMLRIELDVEKEDNTQTTKA 77
            :..::|.||:....|.|:|:| .:::..:|:|........|    ..|.:.:.|...||.:...:
  Fly    12 QDASLPTWVEKKELEALVKQI-SEFRKIESLRWKWETQLAE----PALCVHIQVLVADNKKRQVS 71

  Fly    78 FMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVPELEQLYRDVGLEVKFGAELYDIEASDYYVLL 142
            :::|:|.......| :.:|..|..||.|:..|:|.||:||::....|.||..:...:....::..
  Fly    72 YLIKSPETVPVGLK-LPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKSSHIYG 135

  Fly   143 EDLRPRGFGNIDRLEGMDQAHTECVLKKFAQWHAASAVRV-ETKGPYQE--KYTKGFLRNEEIV- 203
            :.:..:|:...:.|:|:.....|.||.|.|.:||.:|..: :|.|..:|  |..:....:||.. 
  Fly   136 DYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSDEETAE 200

  Fly   204 ----------DAFINRSIKVFLDNVHLCKGYETYLNDLRIVSGKTFEIVESLNNPSPDEFIALNH 258
                      ::..:...:.:.|.|   |.::.|     :.||.  ||::|..:     |..:.:
  Fly   201 LKSLYQLRFHESLRSNDARQYEDKV---KSFQKY-----VKSGT--EILDSKTS-----FNVILN 250

  Fly   259 GDGWANNIMSQYNTKGEIQDTYFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYHSE 323
            |..|.||::.|.:..|.::||.|......::|....||:..||::.:  .|:|:||.::.|||.:
  Fly   251 GSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPA--EKSSRFDGYVKFYHDQ 313

  Fly   324 LVKHLKLLGYSKTLPTLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKVLGDDDCSFKN 388
            |:::|.||.:....|:|..:...|.||..|:|.....||..||.|          .|::|.   .
  Fly   314 LIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSD----------FGNNDI---E 365

  Fly   389 SLYINPRFRKHMEVLLPWLQHRGAME 414
            .|:.||.|.:.:..||||:::||..|
  Fly   366 ELFRNPVFGEQIRELLPWMENRGYFE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 74/294 (25%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 72/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442574
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.