powered by:
Protein Alignment CG10553 and LOC3290895
DIOPT Version :10
| Sequence 1: | NP_651383.1 |
Gene: | CG10553 / 43064 |
FlyBaseID: | FBgn0039324 |
Length: | 414 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_559533.7 |
Gene: | LOC3290895 / 3290895 |
VectorBaseID: | AGAMI1_006391 |
Length: | 423 |
Species: | Anopheles gambiae |
| Alignment Length: | 45 |
Identity: | 11/45 - (24%) |
| Similarity: | 19/45 - (42%) |
Gaps: | 16/45 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 127 PWQPVTKQGQGQRMGGGKGAIDHYVTPVKSGRVIVELAGELEFVE 171
|.:||...|..:: ||..| |:.||.::::|
Mosquito 397 PSKPVLLAGDKEK----KGMAD------------VDAAGGIQYLE 425
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG10553 | NP_651383.1 |
EcKL |
52..333 |
CDD:397213 |
11/45 (24%) |
| LOC3290895 | XP_559533.7 |
None |
Return to query results.
Submit another query.
